SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A096NYP8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A096NYP8
Domain Number 1 Region: 1-183
Classification Level Classification E-value
Superfamily EF-hand 3.49e-28
Family Calmodulin-like 0.0000568
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A096NYP8
Sequence length 185
Comment (tr|A0A096NYP8|A0A096NYP8_PAPAN) Calcium and integrin binding family member 4 {ECO:0000313|Ensembl:ENSPANP00000018211} KW=Complete proteome; Reference proteome OX=9555 OS=Papio anubis (Olive baboon). GN=CIB4 OC=Catarrhini; Cercopithecidae; Cercopithecinae; Papio.
Sequence
MGQCLRYQMHWEDLEEYQALTFLTRNEILCIHDTFLKLCPPGKYYKEATLTMDQVSSLPA
LRVNPFRDRICRVFSHKGVFSFEDVLGMASVFSEQACPSLKIEYAFRIYDFNENGFIDEE
DLQRIILRLLNSDDMSEDLLMDLTNHVLSESDLDDDNMLSFSEFEHAMAKSPDFMNSFRI
HFWGC
Download sequence
Identical sequences A0A096NYP8
ENSPANP00000018211

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]