SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A096P0Y0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A096P0Y0
Domain Number 1 Region: 68-277
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 9.26e-70
Family alpha-catenin/vinculin 0.00041
Further Details:      
 
Domain Number 2 Region: 392-524
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 1.26e-36
Family alpha-catenin/vinculin 0.0018
Further Details:      
 
Domain Number 3 Region: 556-629
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 1.73e-19
Family alpha-catenin/vinculin 0.019
Further Details:      
 
Weak hits

Sequence:  A0A096P0Y0
Domain Number - Region: 291-396
Classification Level Classification E-value
Superfamily FAT domain of focal adhesion kinase 0.0157
Family FAT domain of focal adhesion kinase 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A096P0Y0
Sequence length 636
Comment (tr|A0A096P0Y0|A0A096P0Y0_PAPAN) Catenin alpha like 1 {ECO:0000313|Ensembl:ENSPANP00000019005} KW=Complete proteome; Reference proteome OX=9555 OS=Papio anubis (Olive baboon). GN=CTNNAL1 OC=Catarrhini; Cercopithecidae; Cercopithecinae; Papio.
Sequence
MAASPGPAGVGGAGAVYGSGPLGFALDSGLEIKTRSVEQTLLPLVSQITTLINHKDNTKK
SDKTLQAIQRVGQAVNLAVGRFVKVGEAIANENWDLKEEINIACIEAKQAGETIAALTDI
TNLNHLESDGQITIFTDKTGVIKAARLLLSSVTKVLLLADRVVIKQIITSRNKVLATMER
LEKVNSFQEFVQIFSQFGNEMVEFAHLSGDRQNDLKDEKKKAKMAAARAVLEKCTMMLLT
ASKTCLRHPNCESAHKNKEGVFDRMKVALDKVIEIVTDCKPNGETDISSVSIFTGIKEFK
MNIEALRENLYFQSKENLSVTLEVILERTEDFTDSAYTSHEHRERILELSTQARMELQQL
ISVWIQAQSKKTKSIAEELELSILKISHSLNELKKELHSTATQLAADLLKYHADHVVLKA
LKLTGVEGNLEALAEYACKLSEQKEQLVETCRLLRHISGTEPMEITCIHAEETFQVTGQQ
IISAAETLTLHPSSKIAKENLDVFCEAWESQISDMSTLLREISDVFEGRRGEKYGYLSLP
KPMKNNANLKSLKPDKPDSEEQAKIAKLGLKLGLLTSDADCEIEKWEDQENEIVQYGRNM
SSMAYSLYLFTRGEGPLKTSQDLIHQLEVCLVSLLC
Download sequence
Identical sequences A0A096P0Y0
ENSPANP00000019005

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]