SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A096P165 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A096P165
Domain Number - Region: 636-677
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0156
Family EGF-type module 0.097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A096P165
Sequence length 924
Comment (tr|A0A096P165|A0A096P165_PAPAN) Transmembrane protein 8B {ECO:0000313|Ensembl:ENSPANP00000019090} KW=Complete proteome; Reference proteome OX=9555 OS=Papio anubis (Olive baboon). GN=TMEM8B OC=Catarrhini; Cercopithecidae; Cercopithecinae; Papio.
Sequence
MAQPLSRPLVLSRSPPWPPVPPSPRFPNRPQPLPGSPSRTPFQSLPLAWPPSRPQPSFHP
LSQISAQGLSQPHSQCLLKALAQPRPLLQSPSQPLLPSHSLPLFKPQCPAQPNPLSQLLP
SSLCLPKSLPLVPPISYTLPLSQPRLKSGFQLPPALLLLLLFSVLGPGAGGLFLTDYSTC
SPRKLSPFRSFASTELFHFHVPEDTFLAVWNLIIFKEQGGTFGDHCPDQSVTVYFRSGAP
PVINPLHTHFPGDTAVPGVFSLTLSWTLPNRTSGIFNVSSPLPGDWFLAAHLPQAHGHIS
VKGLQDECQYLLQPQLIVRRLLDVAVLVPGRPSEQTLSPHNRSALYKVFVPSFTYRVSAQ
LACVGGRGVSACPLSLRLRPKAPPLHNSSSVSCGGASGCQLELALPPWGHWVYVRVETSS
RGPGRTIRFQLCVRLQECPQPGLLRALVPGAAMNMPQSLGNQPLPPEPPSLGTPAEGPGT
TSPPEHCWPVRPTLRNELDTFSVHFYIFFGPSVALPPERPAVFAMRLLPVLDSGGVLSLE
LQLNASSVRQENVTVFGCLTHEVPLSLGDAAVTCSKESLAGFLVSVSATTRVARLRIPFP
QTGTWFLALRSLCGVGPRFVRCRNATAEVRMRTFLSPCVDDCGPYGQCKLLRTHNYLYAA
CECKAGWRGWGCTDSADALTYGFQLLSTLLLCLSNLMFLPPVVLAIRSRYVLEAAVYTFT
MFFSTFYHACDQPGIVVFCIMDYDVLQFCDFLGSLMSVWVTVIAMARLQPVVKQVLYLLG
AMLLSMALQLDRHGLWNLLGPSLFALGILATAWTVRSVRRRHCYPPTWRRWLFYLCPGSL
IAGSAVLLYAFVETRDNYFYIHSIWHMLIAGSVGFLLPPRAKTDHRVPSGARARGCGYQL
CINEQEELGLVGPGGATVSSICAS
Download sequence
Identical sequences A0A096P165
ENSPANP00000019090

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]