SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A096P223 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A096P223
Domain Number 1 Region: 375-627
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 7.24e-71
Family Protein kinases, catalytic subunit 0.000000000222
Further Details:      
 
Domain Number 2 Region: 11-137
Classification Level Classification E-value
Superfamily SH2 domain 1.25e-32
Family SH2 domain 0.000000138
Further Details:      
 
Domain Number 3 Region: 148-260
Classification Level Classification E-value
Superfamily SH2 domain 2.56e-31
Family SH2 domain 0.000000451
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A096P223
Sequence length 635
Comment (tr|A0A096P223|A0A096P223_PAPAN) Tyrosine-protein kinase {ECO:0000256|PIRNR:PIRNR000604} KW=Complete proteome; Reference proteome OX=9555 OS=Papio anubis (Olive baboon). GN=SYK OC=Catarrhini; Cercopithecidae; Cercopithecinae; Papio.
Sequence
MASSGMADNANHLPFFFGNITREEAEDYLVQGGMSDGLYLLRQSRNYLGGFALSVAHGRK
AHHYTIERELNGTYAIAGGRTHASPADLCHYHSQESDGLVCLLKKPFNRPQGVQPKTGPF
EDLKENLIREYVKQTWNLQGQALEQAIISQKPQLEKLIATTAHEKMPWFHGKISREESEQ
IVLIGSKTNGKFLIRARDNNGSYALCLLHEGKVLHYRIDKDKTGKLSIPEGKKFDTLWQL
VEHYSYKADGLLRVLTVPCQKIGTQGNVNFGGRPQLPGSHPATWSAGGIISRIKSYSFPK
PGHRKPSPAQGNRPESTVSFNPYEPEVAPWAAEKGPQREALPMDTEVYESPYADPEEIRP
KEVYLDRKLLTLEDKELGSGNFGTVKKGYYQMKKVVKTVAVKILKNEANDPALKDELLAE
ANVMQQLDNPYIVRMIGICEAESWMLVMEMAELGPLNKYLQQNRHVKDKNIIELVHQVSM
GMKYLEECNFVHRDLAARNVLLVTQHYAKISDFGLSKALRADENYYKAQTHGKWPVKWYA
PECINYYKFSSKSDVWSFGVLMWEAFSYGQKPYRGMKGSEVTAMLEKGERMGCPAGCPRE
MYDLMNLCWTYDVENRPGFAAVELRLRNYYYDVVN
Download sequence
Identical sequences A0A096P223 F7GLV6 G7PSP1
ENSPANP00000019398 NP_001247964.1.72884 XP_005582280.1.63531 XP_005582281.1.63531 XP_005582282.1.63531 XP_014973556.1.72884 XP_014973557.1.72884 ENSMMUP00000002336 9544.ENSMMUP00000002336 ENSMMUP00000002336

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]