SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A096P2W9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A096P2W9
Domain Number 1 Region: 3-189
Classification Level Classification E-value
Superfamily EF-hand 2.78e-44
Family Calmodulin-like 0.0000000305
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A096P2W9
Sequence length 200
Comment (tr|A0A096P2W9|A0A096P2W9_PAPAN) Recoverin {ECO:0000313|Ensembl:ENSPANP00000019694} KW=Complete proteome; Reference proteome OX=9555 OS=Papio anubis (Olive baboon). GN=RCVRN OC=Catarrhini; Cercopithecidae; Cercopithecinae; Papio.
Sequence
MGNSKSGALSKEILEELQLNTKFSEEELSSWYQSFLRDCPSGRITQQQFQSIYAKFFPDT
DPKAYAQHVFRSFDSNLDGTLDFKEYVIALHMTTAGKTNQKLEWAFSLYDVDGNGTISKN
EVLEIVMAIFKMITPEDVKLLPEDENTPEKRAEKIWKYFGKRDDDKLTEKEFIEGTLANK
EILRLIQFEPQKVKEKIKNA
Download sequence
Identical sequences A0A096P2W9
ENSPANP00000019694

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]