SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A096P3H8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A096P3H8
Domain Number 1 Region: 135-176
Classification Level Classification E-value
Superfamily SAP domain 0.00000000000167
Family SAP domain 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A096P3H8
Sequence length 187
Comment (tr|A0A096P3H8|A0A096P3H8_PAPAN) Cerebral dopamine neurotrophic factor {ECO:0000313|Ensembl:ENSPANP00000019903} KW=Complete proteome; Reference proteome OX=9555 OS=Papio anubis (Olive baboon). GN=CDNF OC=Catarrhini; Cercopithecidae; Cercopithecinae; Papio.
Sequence
MWCASPVAVVAFCAGLWVSHPVLAQGQEAGGRPGADCEVCKEFLNRFYKSLIDRGVNFSL
DTIEKELISFCLDTKGKENRLCYYLGATKDAATKILSEVTRPMSVHMPAMKICEKLKKLD
SQICELKYEKTLDLASVDLQKMRVAELKQILHSWGEECRACAEKTDYVNLIQELAPKYAA
THPKTEL
Download sequence
Identical sequences A0A096P3H8
ENSPANP00000019903

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]