SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A096P568 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A096P568
Domain Number 1 Region: 7-71
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000000000111
Family PHD domain 0.01
Further Details:      
 
Weak hits

Sequence:  A0A096P568
Domain Number - Region: 938-1093
Classification Level Classification E-value
Superfamily Phase 1 flagellin 0.0262
Family Phase 1 flagellin 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A096P568
Sequence length 1098
Comment (tr|A0A096P568|A0A096P568_PAPAN) MLLT6, PHD finger containing {ECO:0000313|Ensembl:ENSPANP00000020493} KW=Complete proteome; Reference proteome OX=9555 OS=Papio anubis (Olive baboon). GN=MLLT6 OC=Catarrhini; Cercopithecidae; Cercopithecinae; Papio.
Sequence
MKEMVGGCCVCSDERGWAENPLVYCDGHACSVAVHQACYGIVQVPTGPWFCRKCESQERA
ARVRCELCPHKDGALKRTDNGGWAHVVCALYIPEVQFANVLTMEPIVLQYVPHDRFNKTC
YICEEQGRESKAASGACMTCNRHGCRQAFHVTCAQMAGLLCEEEVLEVDNVKYCGYCKYH
FSKMKTSRHSSGGGGGGTGGGGGSGGSMGGGGSGFISGRRSRSASPSTQQEKHPTHHERG
QKKSRKDKERLKQKHKKRPESPPSILTPPVVPTADKVSSSASSSSHHEASTQETSESSRD
SKGKKSSSHSLSHKGKKLSSGKGVSSFTSASSSSSSSSSSSGGPFQPAVSSLQSSPDFSA
FPKLEQPEEDKYSKPTAPAPSAPPSPSAPEPPKADLFEQKVVFSGFGPIMRFSTTTSSSG
RARAPSPGDYKSPHVTGSGASAGTHKRMPALSATPVPADETPETGLKEKKHKASKRSRHG
PGRPKGSRNKEGTGAPAAPSLPSAQLAGFTATAASPFSGGSLVSSGLGGLASRTFGPSGS
LPSLSLESPLLGAGIYTSNKDPISHSGGMLRAVCSTPLSSSLLGPPGTSALPRLSRSPFT
STLPSSSASISTTQVFSLAGSTFSLPSTHIFGTPMGAVNPLLAQAESSHTEPDLEDCSFR
CRGTSPQESLSSMSPISSLPALFDQTASAPCGGGQLDPAAPGTTNMEQLLEKQGDGEAGV
NIVEMLKALHALQKENQRLQEQILSLTAKKERLQILNVQLSVPFPALPAALPAANGPVPG
PYGLPPQAGSSDSLSTSKSPPGKSSLGLDNSLSTSSEDPHSGCPSRSSSSLSFHSTPPPL
PLLQQSPATLPLALPGAPAPLPPQPQNGLGRAPGAAGLGAMPMAEGLLGGLAGSGGLPLN
GLLGGLNGAAAPNPASLSQAGGAPTLQLPGCLNSLTEQQRHLLQQQEQQLQQLQQLLASP
QLTPEHQTVVYQMIQQIQQKRELQRLQMAGGSQLPMASLLAGSSTPLLSAGTPGLLPTAS
APPLLPAGALVAPSLGNNTSLMAAAAAAAAAAVAAAGGPPVLTAQTNPFLSLSGADGSGG
GPKGGTADKGASVNQEKG
Download sequence
Identical sequences A0A096P568
ENSPANP00000020493

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]