SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A096P5H7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A096P5H7
Domain Number 1 Region: 57-137
Classification Level Classification E-value
Superfamily HMG-box 6.68e-24
Family HMG-box 0.00083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A096P5H7
Sequence length 411
Comment (tr|A0A096P5H7|A0A096P5H7_PAPAN) Uncharacterized protein {ECO:0000313|Ensembl:ENSPANP00000020602} KW=Complete proteome; Reference proteome OX=9555 OS=Papio anubis (Olive baboon). GN= OC=Catarrhini; Cercopithecidae; Cercopithecinae; Papio.
Sequence
MSKRPSYAPPPTPAPATQMPSTPGFVGYNPYSHLAYNNYRLGGNPGTNSRVTASSGITIP
KPPKPPDKPLMPYMRYSRKVWDQVKASNPDLKLWEIGKIIGGMWRDLTDEEKQEYLNEYE
AEKIEYNESMKAYHNSPAYLAYINAKSRAEAALEEESRQRQSRMEKGEPYMSIQPAEDPD
DYDDGFSMKHTATARFQRNHRLISEILSESVVPDVRSVVTTARMQVLKRQVQSLMVHQRK
LEAELLQIEERHQEKKRKFLESTDSFNNELKRLCGLKVEVDMEKIAAEIAQAEEQARKRQ
EEREKEAAEQAERSQSSIVPEEEQAANKGEEKKDDENIPMETEETHLEETTESQQNGEEG
TSTPEDKESGQEGVDSMAEEGTSDSNTGSESNSATVEEPPTDPIPEDEKKE
Download sequence
Identical sequences A0A024R1S7 A0A096P5H7 A0A2I3RU20 A0A2K5M1A0 A0A2K5W018 A0A2K5Z3Q1 A0A2K6ASS5 G1QNI4 H2NU71 H9FYS5 Q969G3
ENSPTRP00000046617 ENSPANP00000020602 ENSP00000323967 gi|21264355|ref|NP_003070.3| NP_001248235.1.72884 NP_003070.3.87134 NP_003070.3.92137 XP_003278319.1.23891 XP_005584163.1.63531 XP_008010971.1.81039 XP_009250076.1.23681 XP_011723530.1.29376 XP_011854322.1.47321 XP_011901933.1.92194 XP_012353163.1.23891 XP_511478.2.37143 ENSPPYP00000009502 ENSP00000323967 ENSPTRP00000046617 ENSNLEP00000002500 ENSP00000323967 9544.ENSMMUP00000005342 9598.ENSPTRP00000046617 9600.ENSPPYP00000009503 9606.ENSP00000323967 ENSMMUP00000005342 ENSPPYP00000009502 ENSMMUP00000005342

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]