SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A096P5W4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A096P5W4
Domain Number 1 Region: 97-242
Classification Level Classification E-value
Superfamily ThrRS/AlaRS common domain 3.27e-32
Family AlaX-like 0.029
Further Details:      
 
Domain Number 2 Region: 3-94
Classification Level Classification E-value
Superfamily Translation proteins 0.0000000000102
Family AlaX-M N-terminal domain-like 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A096P5W4
Sequence length 411
Comment (tr|A0A096P5W4|A0A096P5W4_PAPAN) PTGES3L-AARSD1 readthrough {ECO:0000313|Ensembl:ENSPANP00000020739} KW=Complete proteome; Reference proteome OX=9555 OS=Papio anubis (Olive baboon). GN=PTGES3L-AARSD1 OC=Catarrhini; Cercopithecidae; Cercopithecinae; Papio.
Sequence
MAFRCQRDSYAREFTTTVVSCRPAELQTEGSNGKKVLSGFHVVLEDTLLFPEGGGQPDDR
GTINDISVLRVTRRGEQADHFTQTPLDPGSQVLVRVDWERRFDHMQQHSGQHLVTAVADH
LFKLKTTSWELGRFRSVIELDTPSMTTEQVAAIEQSVNEKIRDRLPVNVRELSLDDPEVE
QVRGRGLPDDHAGPVRVVSIKGVDSNMCCGTHVSNLSDLQVIKILGTEKGKKNKTNLIFL
AGNRVLKWMERSHGTEKALTALLKCGAEDHVEAVKKLQNSTKILQKNNLNLLRDLAVHIA
HSLRNSPDWGGVVVLHRKEGDSEFMNIIANEIGSEETLLFLTVGDEKGAGLFLLAGPPAS
VETLGPRVAEVLEGKGAGKKGRFQGKATKMSRRTEVQALLQDYITTQSTKE
Download sequence
Identical sequences A0A096P5W4
ENSPANP00000020739

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]