SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A096PBE0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A096PBE0
Domain Number 1 Region: 43-228
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 1.5e-36
Family PAPS reductase-like 0.0088
Further Details:      
 
Domain Number 2 Region: 311-403
Classification Level Classification E-value
Superfamily Thioredoxin-like 9.43e-17
Family PDI-like 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A096PBE0
Sequence length 406
Comment (tr|A0A096PBE0|A0A096PBE0_OSTTA) Thioredoxin, conserved site {ECO:0000313|EMBL:CEG01967.1} KW=Complete proteome; Reference proteome OX=70448 OS=Ostreococcus tauri. GN=OT_ostta14g00360 OC=Mamiellales; Bathycoccaceae; Ostreococcus.
Sequence
MTSRARAGPVVQRIARNRVFGDDVKASRRTSRVTPARDARARATALEIVDHALETHGDRI
AIAFSGAEDVAVIQYAALTGRGFRVFSLDTGRLNPETYELFDAVEKHFGIKIEYCFPDAD
AVKALVNEKGMFSFYEDGHKECCGVRKVQPLRAKLATLDAWMTGQRKDQSPGTRNAVPAS
QVDPVFVGAKGGEGSLMKYNPLTDMTSTEVWDFLRVMGTPVNALHERGYVSIGCAPCTRA
VLPGQQEREGRWWWEDAASKECGLHSGNVSDEAKKTQEDREATEEDIFEHELVRALSHDQ
IAALRDEKTHAETTLAVLYAPWCPHCQRMVDGYETAAERLTPNGITFAKFRADRDEKEWA
KENLSLNSFPTVLLFPKGRSGYIKLGSERRDADSLRIFIESVCGKI
Download sequence
Identical sequences A0A096PBE0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]