SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A097EHU2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A097EHU2
Domain Number 1 Region: 57-245
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 0.000000000265
Family Cutinase-like 0.067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A097EHU2
Sequence length 256
Comment (tr|A0A097EHU2|A0A097EHU2_9SPHN) Uncharacterized protein {ECO:0000313|EMBL:AIT07132.1} KW=Complete proteome; Reference proteome OX=1549858 OS=Sphingomonas taxi. GN=MC45_12975 OC=Sphingomonadaceae; Sphingomonas.
Sequence
MASQRSRSLRWRLAWIAGIAGGVLALLAGIAASAGFFDRDAAHLFGPQGIARPIGVLYVS
GDMGLRYGPNPHTVRALAGQGFPVVALSSPALFGLRRTRAEVDRIVADGVRAALARTGAA
RLMLIGQSYGADVLQTGLADLPVALRSHVAGVVLVVPGETVFFRADPSGLVYRGTPDSES
RATLARLGWTHLTCIYGAAEVDSACPDLLAGRRAGRAGQATVVAMPGGHFLNDDRAGLFA
HILAAIRHAAPDAFAR
Download sequence
Identical sequences A0A097EHU2
WP_038663889.1.23589

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]