SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A097IF26 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A097IF26
Domain Number 1 Region: 213-394
Classification Level Classification E-value
Superfamily Thioredoxin-like 4.25e-50
Family Glutathione peroxidase-like 0.00031
Further Details:      
 
Domain Number 2 Region: 1-90
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 2.59e-22
Family PHBH-like 0.00053
Further Details:      
 
Domain Number 3 Region: 101-207
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 4.51e-17
Family FAD-linked reductases, N-terminal domain 0.00033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A097IF26
Sequence length 395
Comment (tr|A0A097IF26|A0A097IF26_9CORY) Phenol 2-monooxygenase {ECO:0000313|EMBL:AIT60731.1} KW=Complete proteome; Reference proteome OX=558173 OS=Corynebacterium doosanense CAU 212 = DSM 45436. GN=CDOO_05295 OC=Corynebacterium.
Sequence
MDMVVDTDFPDWRTKCSIHSKAGSILHIPREGGFLCRIYVDLGQVLEDDNGRIRETPVKK
VIAKANEIYHPYSIDVKDVAWSSVYEVGHRLVDAFDNSNPDNPDHHPHVFLTGDACHTHS
AKAGQGMNVSMQDGFNIGWKLGAVLSGQASEKLLLTYHGERQPAAQNLINFDKQWSTLMA
TPPELLEDPQAVEKFYVSAEEFAAGMLTTYEQNLIVGDTTHQDLATGFPVGRRFKSHKAM
RRCDAVVTHIGHEHVADGRWRIYAFADSPAPGEPSKMTAWADWMKTDDASPLRRFTPAEG
DDNAVFDIKGIYRQGHHDFELFDAPDVFFPRMGTLSLTSYENVYAALPGEDIFAGRGISR
DGAVVVVRPDQYVAAVLPLEDTAGLSEFFDRFLRE
Download sequence
Identical sequences A0A097IF26

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]