SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A098LZG4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A098LZG4
Domain Number 1 Region: 29-104
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000173
Family Growth factor receptor domain 0.0059
Further Details:      
 
Domain Number 2 Region: 95-165
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000439
Family Fibronectin type I module 0.047
Further Details:      
 
Domain Number 3 Region: 224-268
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000929
Family TSP-1 type 1 repeat 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A098LZG4
Sequence length 376
Comment (tr|A0A098LZG4|A0A098LZG4_9SAUR) Protein CYR61 {ECO:0000313|EMBL:JAC95858.1} OX=1550645 OS=Hypsiglena sp. JMG-2014. GN= OC=Toxicofera; Serpentes; Colubroidea; Dipsadidae; Hypsiglena.
Sequence
MNSQRTSCLILAFALLQLINRVVSSSCPDTCECPLEVPKCAPGVGLVLDGCKCCKVCAKQ
LNEDCSKTQPCDHTKGLECNFGASSTALKGICRAQSEGRPCEYNSKIYQNGESFQPNCKH
QCTCIDGAVGCIPLCSQELSLPNLGCPNPRLVKVPGQCCEEWVCDDSKDNLEQLEGFFGK
GFDVDASEGELTRKNELISMIKRKLRILPVFETDIRSHSFENPKCIVQTTSWSQCSKTCG
TGVSTRVTNDNPGCRLVKETRICEVRPCGQPSYDSLKKGKKCTKTKKSQIPVKFTYAGCS
SVKKYRPKYCGSCVDGRCCTPQQTRTIKVQFHCDDGETFTKNVMMIQSCRCSYNCPHGNE
AYPNYQLFNDIHKFRD
Download sequence
Identical sequences A0A098LZG4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]