SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A098TM63 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A098TM63
Domain Number 1 Region: 389-511
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 1.55e-19
Family Heme-binding PAS domain 0.04
Further Details:      
 
Domain Number 2 Region: 572-777
Classification Level Classification E-value
Superfamily PP2C-like 0.000034
Family PP2C-like 0.019
Further Details:      
 
Domain Number 3 Region: 347-394
Classification Level Classification E-value
Superfamily HAMP domain-like 0.0000693
Family HAMP domain 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A098TM63
Sequence length 779
Comment (tr|A0A098TM63|A0A098TM63_9CYAN) Uncharacterized protein {ECO:0000313|EMBL:KGF71928.1} KW=Complete proteome; Reference proteome OX=1497020 OS=Neosynechococcus sphagnicola sy1. GN=DO97_14320 OC=Neosynechococcus.
Sequence
MNLTQFFQPATTLIHRLKYPQKFALISCVFILPLGLVMYLLLSEIQTRINFAQKEIVGNL
YLRPLSQLSEKIFQYQFFSHRSLILHQPSQVTTSRALAVTTDFRSLGILDQAFNDRLQTT
ERLKRLEASWHQLAEIQRQQNLSASIPAYQDVLQNLDELRFQVGDQSNLILDPDLDSYYL
MDATLLKLPEIQKNLAEIHLISQQAILRGRILPSEQAKLMLLGVNLKQFRANLKQKIAVA
FANNPKGNLVPQLTEPLTLLTEDVGKLTELLLPLDARQPLQLKQILAQANQSLLQSFQFW
NTAIDELDILLQNRIDGFFRKQVFLTTFVLIILAIVCYLFVGFYLSVMQTISGLSAAADR
MINGNFSEEMALESHDELTEVVQSFNNIADALREAEAKYRGIFENAVEGIFQTTQTGNYL
IANPMLARIYGYDSAEELITALTDIEHQLYVDPHRRSEFTQLIAAQGKVQGFESQVYCKD
GSIIWISESVRAIQDPLGEVIGYEGTVEDITQRKLAEAEIIQLTQRLKHENLRMGAELEV
SRQLQTMLLPSDAELEAVIGLEIAGFMEPAAEVGGDYYDVLQHEGKIRIGIGDVTGHGLE
SGVVMLMAQTAVRTLLTHGETDPTRFLNTVNTIIYENTQRMRSPKNMTLALLNYEAGMLS
LSGQHEEVIIVRRDGRIEPIDTLDLGFPLGLESDITSFVAETQIQLQSGDIAVLYTDGIT
EAMNAQRQQYGLDRMYGILRRHCEDSASNIRQAIIEDLREFIGDQKVFDDITLLILKQR
Download sequence
Identical sequences A0A098TM63

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]