SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0A0LDD2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0A0LDD2
Domain Number 1 Region: 24-119
Classification Level Classification E-value
Superfamily Chaperone J-domain 9.29e-30
Family Chaperone J-domain 0.00025
Further Details:      
 
Domain Number 2 Region: 192-305
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00000000000405
Family Calsequestrin 0.061
Further Details:      
 
Domain Number 3 Region: 439-565
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0000238
Family PDI-like 0.073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0A0LDD2
Sequence length 572
Comment (tr|A0A0A0LDD2|A0A0A0LDD2_CUCSA) Uncharacterized protein {ECO:0000313|EMBL:KGN58737.1} KW=Complete proteome; Reference proteome OX=3659 OS=Cucumis sativus (Cucumber). GN=Csa_3G730990 OC=Benincaseae; Cucumis.
Sequence
METRLASIIFVMAFLFLFRLSLEAKTMDPYKVLGVERNASQREIQKAFHKLSLQYHPDKN
NKKGAQQKFEEINNAYEILSDEEKRKNFDMYGDEKGAPGFGPGSSGDQGGGYTFFTNGGG
RQGQQPFGPGQWQSTGGQGGSQSFSFSFGGPSGSNPFGFGAEDIFSNLFGGGFQGKGSFG
GHSKAQSGPKSSSSIKVINKKSLKKEIVDQGMTWLLFPTASSLKGLDHVQSTIEEVANSL
QGALKVGRIDCDSESSFCKDLGIYPHRTPRIFVYSYIKSSEGSLVEYSGDIAVKSLKSFC
QEHFPRFSQRVNLKQFDFSSSNRGGLPTLMLLSTKKETPVIWRVLSGLFRKQFNFYDAEV
TYASDPSIKKLGVDALPAIVGWLSNGERHVLRTGINVKDLKSAIDDLSNLLNGFEKKNRK
AASRPASRTQSDSGENQIPLLAGSNFDSVCGEKTPVCVIGAFRSSKARNKLESILNMVSQ
KTLSRRQNSTPGSKETVSYALVDATKQVSFLNAFDSAGFKSSDKILIAYKRRKGKFAAYL
DEITEEEVEKFIGSVLNGDVTFTKTHQKPILK
Download sequence
Identical sequences A0A0A0LDD2
XP_004137701.1.97903

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]