SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0A0MTC4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0A0MTC4
Domain Number 1 Region: 131-207
Classification Level Classification E-value
Superfamily dsRNA-binding domain-like 3.61e-22
Family Double-stranded RNA-binding domain (dsRBD) 0.0000299
Further Details:      
 
Domain Number 2 Region: 33-112
Classification Level Classification E-value
Superfamily dsRNA-binding domain-like 8.01e-19
Family Double-stranded RNA-binding domain (dsRBD) 0.00031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0A0MTC4
Sequence length 398
Comment (tr|A0A0A0MTC4|A0A0A0MTC4_HUMAN) Double-stranded RNA-binding protein Staufen homolog 2 {ECO:0000313|Ensembl:ENSP00000428741} KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=STAU2 OC=Catarrhini; Hominidae; Homo.
Sequence
MKALQALQNEPIPERSPQNGESGKDVDDDKDANKSEISLVFEIALKRNMPVSFEVIKESG
PPHMKSFVTRVSVGEFSAEGEGNSKKLSKKRAATTVLQELKKLPPLPVVEKPKLFFKKRP
KTIVKAGPEYGQGMNPISRLAQIQQAKKEKEPDYVLLSERGMPRRREFVMQVKVGNEVAT
GTGPNKKIAKKNAAEAMLLQLGYKASTNLQDQLEKTGENKGWSGPKPGFPEPTNNTPKGI
LHLSPDVYQEMEASRHKVISGTTLGYLSPKDMNQPSSSFFSISPTSNSSATIARELLMNG
TSSTAEAIGLKGSSPTPPCSPVQPSKQLEYLARIQGFQAALSALKQFSEQGLDPIDGAMN
IEKGSLEKQAKHLREKADNNQAPPGSIAQDCKKSNSAV
Download sequence
Identical sequences A0A0A0MTC4
gi|256419001|ref|NP_001157855.1| NP_001157855.1.87134 NP_001157855.1.92137 ENSP00000428741 ENSP00000428741

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]