SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0A0MTN9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0A0MTN9
Domain Number 1 Region: 87-310
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.11e-54
Family C-terminal domain of adrenodoxin reductase-like 0.0000000046
Further Details:      
 
Domain Number 2 Region: 12-141,325-371
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.000000129
Family C-terminal domain of adrenodoxin reductase-like 0.0000166
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0A0MTN9
Sequence length 439
Comment (tr|A0A0A0MTN9|A0A0A0MTN9_HUMAN) NADPH:adrenodoxin oxidoreductase, mitochondrial {ECO:0000256|PIRNR:PIRNR000362} KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=FDXR OC=Catarrhini; Hominidae; Homo.
Sequence
MEDKDREHPQAHVDIYEKQPVPFGLVRFGVAPDHPEVKNVINTFTQTAHSGRCAFWGNVE
VGRDVTVPELQEAYHAVVLSYGAEDHRALEIPGEELPGVCSARAFVGWYNGLPENQELEP
DLSCDTAVILGQGNVALDVARILLTPPEHLERTDITKAALGVLRQSRVKTVWLVGRRGPL
QVAFTIKELREMIQLPGARPILDPVDFLGLQDKIKEVPRPRKRLTELLLRTATEKPGPAE
AARQASASRAWGLRFFRSPQQVLPSPDGRRAAGVRLAVTRLEGVDEATRAVPTGDMEDLP
CGLVLSSIGYKSRPVDPSVPFDSKLGVIPNVEGRVMDVPGLYCSGWVKRGPTGVIATTMT
DSFLTGQMLLQDLKAGLLPSGPRPGYAAIQALLSSRGVRPVSFSDWEKLDAEEVARGQGT
GKPREKLVDPQEMLRLLGH
Download sequence
Identical sequences A0A0A0MTN9
ENSP00000445432 NP_001244945.2.87134 NP_001244945.2.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]