SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0A0MTS2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0A0MTS2
Domain Number 1 Region: 19-569
Classification Level Classification E-value
Superfamily SIS domain 4.73e-234
Family Phosphoglucose isomerase, PGI 6.95e-16
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0A0MTS2
Sequence length 573
Comment (tr|A0A0A0MTS2|A0A0A0MTS2_HUMAN) Glucose-6-phosphate isomerase {ECO:0000256|RuleBase:RU000612} KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=GPI OC=Catarrhini; Hominidae; Homo.
Sequence
TSGQRPAKRRRKSPAMAALTRDPQFQKLQQWYREHRSELNLRRLFDANKDRFNHFSLTLN
TNHGHILVDYSKNLVTEDVMRMLVDLAKSRGVEAARERMFNGEKINYTEGRAVLHVALRN
RSNTPILVDGKDVMPEVNKVLDKMKSFCQRVRSGDWKGYTGKTITDVINIGIGGSDLGPL
MVTEALKPYSSGGPRVWYVSNIDGTHIAKTLAQLNPESSLFIIASKTFTTQETITNAETA
KEWFLQAAKDPSAVAKHFVALSTNTTKVKEFGIDPQNMFEFWDWVGGRYSLWSAIGLSIA
LHVGFDNFEQLLSGAHWMDQHFRTTPLEKNAPVLLALLGIWYINCFGCETHAMLPYDQYL
HRFAAYFQQGDMESNGKYITKSGTRVDHQTGPIVWGEPGTNGQHAFYQLIHQGTKMIPCD
FLIPVQTQHPIRKGLHHKILLANFLAQTEALMRGKSTEEARKELQAAGKSPEDLERLLPH
KVFEGNRPTNSIVFTKLTPFMLGALVAMYEHKIFVQGIIWDINSFDQWGVELGKQLAKKI
EPELDGSAQVTSHDASTNGLINFIKQQREARVQ
Download sequence
Identical sequences A0A0A0MTS2
ENSP00000465858 ENSP00000465858

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]