SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0A0MU51 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0A0MU51
Domain Number 1 Region: 66-104
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000438
Family EGF-type module 0.022
Further Details:      
 
Domain Number 2 Region: 329-635
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.00000265
Family Rhodopsin-like 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0A0MU51
Sequence length 650
Comment (tr|A0A0A0MU51|A0A0A0MU51_PAPAN) Adhesion G protein-coupled receptor E3 {ECO:0000313|Ensembl:ENSPANP00000000678} KW=Complete proteome; Reference proteome OX=9555 OS=Papio anubis (Olive baboon). GN=ADGRE3 OC=Catarrhini; Cercopithecidae; Cercopithecinae; Papio.
Sequence
MQGSSLLPGLCFLLSFFGAVIPKIKASCNCPPNASCVNNSHCTCNSGYISRSGQTLFTFP
LETCNDINECEPPYSVYCGSNAACHNVAGSFHCHCVPGYRLQSGEERFSNSSENTCQDTN
SSKTTQGKKELQKIVDTFESLLTNQTLWRTEGRQEISSTATTILQDVESKVLETALKVPE
QKVQKIQNSSVAIETRVITDNCSEERKTFNLNVQMNSMDIHCNDVIQKDTQGPSAVAFIS
YSSLGNIINATFFEETDEKDRVFLNSQVVSAAIGPKRNVSLSKSVTLTFQHVKMNHSIKK
AFCVYWETTKQGGLWSRDGCFLIHVNKSHTMCNCSHLSSFAVLMAFTSQEEDPVLTIITY
VGLSLSLLCLLLAALTFLLCKAIQNTSTSLHLQLSLCLFVAHLLFLVGIDQTESKVLCAI
IAGALHYLYLAAFTWMLLEGLHLFLTARNLTVVNYSSINRLMKWIMFPVGYGVPAVTVAI
SAASRPHLYGTADRCWLHLDQGFIWGFLGPVCAIFSVNLVFFILVFWILKRKLSSLNSEV
STIQNTRMLAFKATAQLFILGCTWCLGFLQVGPAAQVMAYLFTIINSLQGFFIFLVYCLL
SQQVQKQYQKWFREIVKSKSESETYTLSSKVGPDSKPSEGDVFPGQVKRK
Download sequence
Identical sequences A0A0A0MU51
ENSPANP00000000678

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]