SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0A0MV08 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0A0MV08
Domain Number 1 Region: 345-473
Classification Level Classification E-value
Superfamily TIMP-like 8.48e-29
Family Tissue inhibitor of metalloproteinases, TIMP 0.037
Further Details:      
 
Domain Number 2 Region: 212-266
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000198
Family Laminin-type module 0.027
Further Details:      
 
Domain Number 3 Region: 157-214
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000837
Family EGF-type module 0.07
Further Details:      
 
Domain Number 4 Region: 275-315
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000614
Family Laminin-type module 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0A0MV08
Sequence length 489
Comment (tr|A0A0A0MV08|A0A0A0MV08_PAPAN) Netrin 5 {ECO:0000313|Ensembl:ENSPANP00000004714} KW=Complete proteome; Reference proteome OX=9555 OS=Papio anubis (Olive baboon). GN=NTN5 OC=Catarrhini; Cercopithecidae; Cercopithecinae; Papio.
Sequence
MPVTFALLLLLGQATADPCYDPQGRPQFCLPPVTQLAAVAASCPQACALSTGNHLGPGET
CNGSLTLALGGSFLLTSVSLRFCTPGPPALILSAAWASGGPWRLLWHRPAWPRALGGPER
VTFHSTPDPKATVVASHLRVEFGGQAGLAAAGLRGRCQCHGHAARCAARARPPRCHCRHH
TTGPGCESCRPSHRDWPWRPATPRHPHPCLPCSCNQHARRCRFNSELFRLSGGRSGGVCE
RCRHHTAGRHCHYCQPGFWRDPSQPMSSRRACRACQCHPIGATGGTCNQTSGQCTCKLGV
TGLTCNRCGPGYQQSRSPRMPCQRIPEATTTLATTPGAYSSDPQCQNYCNMSDTRVYMSL
RRYCQQDYVLRAQVLASEAAGPAWRRLAVRVQAVYKQRAQLVRRGDQDAWVPRADLACGC
LRLQPGTDYLLLGSVVGGPDPTRLILDRHGLALPWRPRWARPLRRLQQEERAGGCRGVRA
PTSSPRPEH
Download sequence
Identical sequences A0A0A0MV08
ENSPANP00000004714

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]