SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0A0MVU7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0A0MVU7
Domain Number 1 Region: 405-518
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 1.83e-17
Family Mannose 6-phosphate receptor domain 0.0072
Further Details:      
 
Domain Number 2 Region: 68-108
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000419
Family LDL receptor-like module 0.0048
Further Details:      
 
Domain Number 3 Region: 210-257
Classification Level Classification E-value
Superfamily EF-hand 0.0000742
Family Calmodulin-like 0.065
Further Details:      
 
Weak hits

Sequence:  A0A0A0MVU7
Domain Number - Region: 31-66
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000209
Family LDL receptor-like module 0.0041
Further Details:      
 
Domain Number - Region: 127-222
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.00439
Family FCH domain 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0A0MVU7
Sequence length 534
Comment (tr|A0A0A0MVU7|A0A0A0MVU7_PAPAN) Protein kinase C substrate 80K-H {ECO:0000313|Ensembl:ENSPANP00000007857} KW=Complete proteome; Reference proteome OX=9555 OS=Papio anubis (Olive baboon). GN=PRKCSH OC=Catarrhini; Cercopithecidae; Cercopithecinae; Papio.
Sequence
MLLPLLLLLPMCWAVEVKRPRGVSLTNHHFYDESKPFTCLDGSATIPFDQVNDDYCDCKD
GSDEPGTAACPNGSFHCTNTGYKPLYIPSNRVNDGVCDCCDGTDEYNSGIVCENTCKEKG
RKERESLQQMAEVTREGFRLKKILIEDWKKAREEKQKKLIELQAGKKSLEDQVETLRTVK
EEAEKPEKEAKEQHQRLWEEQLAATKVQREQALAADAFQELDDDMDGTVSVTELQTHPEL
DTDGDGVLSEAEAQALLSGDTQTDASSFFDRVWAAIRDKYRSEALPTDLPAPSAPDLTEP
KEEQPPVPSPPTEEEEEEEEEEEAEEEEEEEEDSEVQGEQPKEALLPLAPPQPASPAEED
KMPPYDEQTQAFIDAAQEARNKFEEAERSLKDMEESIRNLEQEISFDFGPNGEFAYLYSQ
CYELTTNEYVYRLCPFKLVSQKPKLGGSPTSLGTWGSWAGPEHDRFSAMKYEQGTGCWQG
PNRSTTVRLLCGKETMVTSTTEPSRCEYLMELMTPAACLEPPPEAPTEDDHDEL
Download sequence
Identical sequences A0A0A0MVU7
ENSPANP00000007857

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]