SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0A0MXI6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0A0MXI6
Domain Number 1 Region: 1043-1211
Classification Level Classification E-value
Superfamily C-type lectin-like 1.05e-42
Family C-type lectin domain 0.00000578
Further Details:      
 
Domain Number 2 Region: 150-267
Classification Level Classification E-value
Superfamily C-type lectin-like 2.83e-37
Family Link domain 0.0015
Further Details:      
 
Domain Number 3 Region: 268-363
Classification Level Classification E-value
Superfamily C-type lectin-like 4.05e-28
Family Link domain 0.0036
Further Details:      
 
Domain Number 4 Region: 1212-1272
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000264
Family Complement control module/SCR domain 0.0019
Further Details:      
 
Domain Number 5 Region: 44-157
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000163
Family V set domains (antibody variable domain-like) 0.024
Further Details:      
 
Domain Number 6 Region: 1008-1049
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000252
Family EGF-type module 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0A0MXI6
Sequence length 1320
Comment (tr|A0A0A0MXI6|A0A0A0MXI6_PAPAN) Neurocan {ECO:0000313|Ensembl:ENSPANP00000017817} KW=Complete proteome; Reference proteome OX=9555 OS=Papio anubis (Olive baboon). GN=NCAN OC=Catarrhini; Cercopithecidae; Cercopithecinae; Papio.
Sequence
MGATFVWALGLLMPQMLLFVAGEQGTQDIADASERGLHMQKLGSGSVRAALAELVALPCL
FTLQPRPSAARDAPRIKWTKVRTASGQRQDLPILVAKDNVVRVAKSWQGRVSLPAYPRRR
VNATLLLGPLRASDSGLYRCQVVRGIEDEQDLVPLEVTGVVFHYRAAQDRYALTFAEAQE
ACHLSSAIIAAPRHLQAAFEDGFDNCDAGWLSDRTVRYPITQSRPGCYGDRSSLPGVRSY
GRRNPQELYDVYCFARELGGEVFYVGPARRLTLAGARAQCRRQGAALASVGQLHLAWHEG
LDQCDPGWLADGSVRYPIQTPRRRCGGPAPGVRTVYRFANRTGFPSPAARFDAYCFRAHH
PTSQHGDLETPSSGDEGEILSAEGPPVRELEPTLEEEEVVTPDFQEPLVSSGEEEPLILA
EKQESQQTLSPTPGDPMLASWPTGEVWLSTVAPSPSDMGAGTTASSHTEVAPTDPTARRR
GRFKGLNGRYFQQQEPEPGLQEGMEASAQPPTSEAVGNQVEPPLAMAVTEMLGSGHSRSP
WADLTNEVDMPGAGSAGGKSSPEPWLWPPTMVPPSISGHSRAPVPELEKAEGPSARPATP
DLFWSPLEATVSAPSPAPWEASPLATSPDLPMMAMLRGPKQWMLPHPTSVSTEASRVEGH
GEATATAPPSPAAETKVYSLPPFSTPTGQGGEAMPTTPESPRPDFREIGETSLAQVHKVE
HPSSSPWPSVNRNVAVGFVPTETATELTGLRGISGSESGVFDTAESPTSGLQATVDEVQD
PWPSVYSKGPGASSPSAPSGSPGLFLVPKVTPSLEPWVATDEGPTVNPKDSTVTPAPSDA
SGIWEPGSQSFEEAESTTLSPQVALDTSVVTSLTTEQGDKVGVPAVSTLASSSSQPHPEP
EDQVETQGTSGTLAPPHQSSPLGKPAVPPGTPTAASVGESALVSSGEPTVPWDPSSTLLP
VTLGIEDFKLEVLAGSPGVESFWEEVASGEEPALSGTPTNEGAEEAHSDPCENNPCLHGG
TCNANGTMYGCSCDQGFAGENCEIDIDDCLCSPCENGGTCIDEVNGFVCLCLPSYGGSLC
EKDTEGCDRSWHKFQGHCYRYFAHRRAWEDAERDCRRRSGHLTSVHSPEEHSFINSFGHE
NTWIGLNDRIVERDFQWTDNTGLQFENWRENQPDNFFAGGEDCVVMVAHESGRWNDVPCN
YNLPYVCKKGTVLCGPPPAVENASLIGTRKAKYNVHATVRYQCNEGFAQHHVATIRCRSN
GKWDRPQIVCTKPRRSHRMRRHHHHHQHHHQHHHHKSHKERRKHKKHPTEDWEKDEGNFC
Download sequence
Identical sequences A0A0A0MXI6
ENSPANP00000017817

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]