SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0A0QZF0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0A0QZF0
Domain Number 1 Region: 68-223
Classification Level Classification E-value
Superfamily Virus ectodomain 2.56e-52
Family Virus ectodomain 0.0000001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0A0QZF0
Sequence length 267
Comment (tr|A0A0A0QZF0|A0A0A0QZF0_9MONO) Fusion glycoprotein F0 {ECO:0000256|RuleBase:RU003705, ECO:0000256|SAAS:SAAS00628579} OX=11176 OS=Avian avulavirus 1. GN= OC=Mononegavirales; Paramyxoviridae; Avulavirus.
Sequence
MDPKPSTSYLHVFPLISVAISSVFMAEKVSALDGRPLAAAGIVVTGDKAVNIYTSSQTGT
IIIKLLPNMPKDKEQCAKSPLDAYNRTLTTLLAPLGDSIRRIQESVTTSGGERQERLIGA
IIGGVALGVATAAQITAASALIQANQNAANILKLKESIAATNEAVHEVTSGLSQLAVAVG
KMQQFVNEQFNKTAQEIDCIKITQQVGVELNLYLTELTTVFGPQITSPALTQLTIQALYN
LAGGNMDYMLTKLGVGNNQLSSLISSG
Download sequence
Identical sequences A0A0A0QXS0 A0A0A0QZF0 A0A0A0R2K9 A0A0A0R3X3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]