SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0A1P182 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0A1P182
Domain Number 1 Region: 395-635
Classification Level Classification E-value
Superfamily vWA-like 1.75e-74
Family Trunk domain of Sec23/24 0.00000337
Further Details:      
 
Domain Number 2 Region: 145-308,638-732
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 5.1e-55
Family beta-sandwich domain of Sec23/24 0.00016
Further Details:      
 
Domain Number 3 Region: 310-394
Classification Level Classification E-value
Superfamily Zn-finger domain of Sec23/24 1.57e-26
Family Zn-finger domain of Sec23/24 0.00012
Further Details:      
 
Domain Number 4 Region: 762-854
Classification Level Classification E-value
Superfamily C-terminal, gelsolin-like domain of Sec23/24 0.0000000000000445
Family C-terminal, gelsolin-like domain of Sec23/24 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0A1P182
Sequence length 858
Comment (tr|A0A0A1P182|A0A0A1P182_9FUNG) Putative ER to Golgi transport-related protein {ECO:0000313|EMBL:CEI98662.1} KW=Complete proteome; Reference proteome OX=58291 OS=Rhizopus microsporus. GN=RMCBS344292_12765 OC=Rhizopodaceae; Rhizopus.
Sequence
MQQSPASQPIQRPPIPNQPVRPGYRPPPPGAPGYRPPMPRPGMQSPVGASPLPPHPGLPP
NVRPGPIPPQPQQRPLVRPVSQSPVMAPAGRPAVVSSPVATPSTIQQQSPMSPPVQHAEH
YKKKRMYPEQITKAYSGESPVPPAYPSQQLQQPYVSPAMANQQPQFISPMGAPSPYAQQQ
QQIQQPQPQQQQPQAYGQYQAPSVGYNTYGQDAVGQMATQFGNMSMGPAAVVPAVPLLGA
RPHIADIDNTGPQVRLPPNISVTDSPFVNADPSYQCSTLNAIPATESLLKKSRLPLALVL
TPYRSLKEGDDSVPVVRDSVIARCRRCRTYINPFATFVEGGQRWKCNMCFLLNDVPAAFD
YDSITQQPADRWKRPELNYGCVEFVAPTEYMVRPPQAPAYVFVIDVSYSAIQSGMVATAA
RTILDSLERLPNDENRTKVAIITVDSSLHFYNLNPSLNEPQMLVVSDLDDVYLPSPSDLL
VNLTESIHILKALLEKLPELFKDSMNVNNALGTGLQAAFKMLSPIGGKIICLQSTLPNTG
AGALKPREDVKLLGTSKESSLLNAASPFYKSFAVDCSRSQVACDMVIFGGQYSDVATLSC
VPHYTGGQTYYYPGFNASRTEDAIKFAHEFSELLAEQIGLEAVIRIRASRGLRMSAFHGN
FFIRSSDLLALPNVPRDQKYVVEVTMEDDLKTPTVCFQTALLHTACNGERRIRVVTTCLP
VSSSMSELYASANQQAITAYLGVKAVERGLTSKLDDARDAILCVDLFDVKSYEGLKGGKI
TLPVLNTPLNKKVNTIIGKVREMRRGNYHPTLYLVKEDGDPYLRLWFLAHSIEDRTDNIM
SYQQFLQHIKDRVSSGSF
Download sequence
Identical sequences A0A0A1P182

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]