SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0A1U824 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0A1U824
Domain Number 1 Region: 359-497
Classification Level Classification E-value
Superfamily HCP-like 2.88e-17
Family HCP-like 0.012
Further Details:      
 
Domain Number 2 Region: 438-561,595-673
Classification Level Classification E-value
Superfamily HCP-like 4.19e-17
Family HCP-like 0.0099
Further Details:      
 
Domain Number 3 Region: 646-767
Classification Level Classification E-value
Superfamily HCP-like 1.15e-16
Family HCP-like 0.0059
Further Details:      
 
Domain Number 4 Region: 18-81,112-215
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.000000000691
Family Calponin-homology domain, CH-domain 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0A1U824
Sequence length 774
Comment (tr|A0A0A1U824|A0A0A1U824_ENTIV) Uncharacterized protein {ECO:0000313|EMBL:ELP89210.1} KW=Complete proteome; Reference proteome OX=370355 OS=Entamoeba invadens IP1. GN=EIN_486520 OC=Eukaryota; Amoebozoa; Archamoebae; Entamoebidae; Entamoeba.
Sequence
MDISDTTTNFESYEPLLVNWLRYELRGIRQDEPDFSTFRDGLLLRQLYEKVNDLAQTKTF
PASSFVEAVYENSIVISTIFNSSNPTLDNQFTLGETQSVISVLVKLFLNTQKANTVISFI
NSTIESLEPVLGRHINNLSSEWSDGSLFTQLFLILFPSISPSFFNNIERPVDAIDLCIDQ
AYLLVKIPKLITAQGVVFLHEEFSLAMYFSYFKSFIKSAPKKRIMRYDEITQSKMVKLIQ
NDDENYKIAPVLTKPKTETVEKVETIIQTTAEIIPEGETQKEFNINIYQDNPHLEKDKED
LEKLKQLSNWYEGINLDLLYESPMLLFTPDKNNLAAEKIRLFGNSKFQKNNKKFMKQYYE
RGCCLLRGLLVPMSEKSAFENFEMAAKFGHIASIHNLGLMKERGMGCPQDKRGAREMYKV
ALNSGCLYSCNNLAVLQYISGDVNSAQTNWRFSAGKGLLCSLNNLGVSLITSEPDRAVKM
LVESARYGNMYSIFNLGVLAFKGLPGLIPVNIKTSIDLFTRSFGVVQSRYNLGVLSQMGV
GVPKDEKKALRYYSQSLCSETSSEVNIAISFLYGDYNKEREEDMTVKILKSHNTGVCKFH
LGMCYRKGCGVLESATKSAECYKESMGAGNEFAKFHVACVKMIHHDDKKESLELVKEAVE
AGYWVAKSWYGRYLYQENKEEGLSLIREACRMQDKRALYALSIHLYKEENKLNESIQILN
TLVASNFKEAIVTLGVFYLKGVGVQKDVSQACSLWRKAKSLGDKTAESFIKACE
Download sequence
Identical sequences A0A0A1U824
XP_004255981.1.21224 jCVI|EIN_289010

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]