SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0A2IEY6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0A2IEY6
Domain Number 1 Region: 60-227
Classification Level Classification E-value
Superfamily Homo-oligomeric flavin-containing Cys decarboxylases, HFCD 1.28e-18
Family Homo-oligomeric flavin-containing Cys decarboxylases, HFCD 0.0004
Further Details:      
 
Domain Number 2 Region: 370-380,423-538
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.00000144
Family Pseudo ankyrin repeat 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0A2IEY6
Sequence length 618
Comment (tr|A0A0A2IEY6|A0A0A2IEY6_PENEN) Flavoprotein {ECO:0000313|EMBL:KGO58920.1} KW=Complete proteome; Reference proteome OX=27334 OS=Penicillium expansum (Blue mold rot fungus). GN=PEX2_092750 OC=Eurotiomycetidae; Eurotiales; Aspergillaceae; Penicillium.
Sequence
MAVGFRPNISPIKKGNTITKGSWLSDMEVDGGCKETVIGNKAVQNATSSQPRRRRLLLST
DSAFADTVLPSLVQNPYIELRLITDEPSALLTGTNKIPHYMDTVDSQTFDKKTGARKWLK
AKTAELCEWADMLLVAPIDAGALGAMLAGLTNTLTLALLRGWVSKKPVILIPGMTVSEWD
HPLSTRQLDEISRFWPWIRTVKPVLWKSNGPEDLTILPWDGLEELHQTLETTLKVPPWEA
TLSTRAIPHGTTVPVKTASKSTSGTATGSTPQTKHTGNADFLPLEIWLNVFEDQLRDWET
AKAVGIPTHLPVPQEWQSHLPKMSTTASLEYTILRGSFAAIKKRIDALPRWKPLSDLACH
LIVKFSRTDILSYLTENHLDLLWTTSRLTNIPYRASAIYGNPNVLTWWRDAPALPNKEYM
ADAMDGASRAGFVDVLDWWLHSGLPLRYSERALEAASAEGRVPVLDWWKTASTNAPVSSP
LPLKVGKSVLLAAQSGRTASLAWWDASGIPYSHAENVARIASTHGHVHVLEFWYKLKGPK
MIFDNQVLVGPTKNGHDHILQWWKSCGMRVEFKTCDIEEALEDADPSSGAEGRVRRWWER
NGLNLGVGTSEWMRSKVL
Download sequence
Identical sequences A0A0A2IEY6
XP_016600261.1.99153

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]