SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0A3WMM6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0A3WMM6
Domain Number 1 Region: 218-279,311-366
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.0000000144
Family SMI1/KNR4-like 0.019
Further Details:      
 
Domain Number 2 Region: 25-74,104-176
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.0000000327
Family SMI1/KNR4-like 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0A3WMM6
Sequence length 372
Comment (tr|A0A0A3WMM6|A0A0A3WMM6_XANCH) Glucan biosynthesis protein {ECO:0000313|EMBL:KHD62309.1} KW=Complete proteome OX=317013 OS=Xanthomonas campestris pv. phaseoli. GN=PK68_13495 OC=Xanthomonadaceae; Xanthomonas.
Sequence
MAALKWMIYGRSPSLDTFWDEPLNLGRMPATEAAIAAAQARLGIRLPGWLLELYARYDGG
AVQMACGQSLEEPDNWLKAEWLIPRARLLGCADLFSFAEVRAGQDYRDDAYDGLAEGGDD
RRLIAIAADDRSPSRALCLDYSASGVEPALVYVDAGNKRRLAVFANVDDLLAQLVDVVYW
SPALQARHDGDAVHWQPQPPAVTTFWSGPGHWNAQAAAADDEAFAAAEARLGVRLPALLK
RLYAVQDGGDTGWCWVPRTRFPSDRYVDWECVLVDRDLPPLAYIRSVLDFADAFEDRTDF
SAAACLHAGLDRVLVLACHNVNSLLCLDYRARGPQHEPEIVYFQTWDGLVPTWRAASFDA
FFGVLRQAELEL
Download sequence
Identical sequences A0A0A3WMM6
WP_039568243.1.14032 WP_039568243.1.25999 WP_039568243.1.31364 WP_039568243.1.34035 WP_039568243.1.49137 WP_039568243.1.52218 WP_039568243.1.56360 WP_039568243.1.72777

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]