SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0B0E311 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0B0E311
Domain Number 1 Region: 9-219
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.19e-66
Family Glutathione peroxidase-like 0.00000223
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0B0E311
Sequence length 225
Comment (tr|A0A0B0E311|A0A0B0E311_NEUCS) Uncharacterized protein {ECO:0000313|EMBL:KHE84575.1} KW=Complete proteome OX=5141 OS=Neurospora crassa. GN=GE21DRAFT_10198 OC=Neurospora.
Sequence
MASTDRNAPLRLGTIAPNFQADTTTGPIDFHEFIGDNWVILFSHPEDYTPVCTTELGEMA
RLEPEFKKRGVKLIGLSANTLGSHEGWINDIKDVTGSQVQFPIIADKERKVAYLYDMLDY
QDTTNVDEKGIAFTIRSVFVIDPKKTIRTILAYPASTGRNSAEILRIVDSLQTGDKHKVT
TPINWVPGDDVIVHPSIKGEEATRLFPNLKAVKPYLRFTPLPKDA
Download sequence
Identical sequences A0A0B0E311 F8MXV4 G4URP8 Q7S4F4
jgi|Neute1|190026|estExt_fgenesh2_kg.C_160007 XP_009854856.1.73169 XP_959621.1.24337 NCU06031T0 5141.NCU06031.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]