SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0B1T8V8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0B1T8V8
Domain Number 1 Region: 15-119
Classification Level Classification E-value
Superfamily Chaperone J-domain 1.22e-26
Family Chaperone J-domain 0.00027
Further Details:      
 
Domain Number 2 Region: 117-204
Classification Level Classification E-value
Superfamily Thioredoxin-like 5.75e-21
Family PDI-like 0.029
Further Details:      
 
Domain Number 3 Region: 400-507
Classification Level Classification E-value
Superfamily Thioredoxin-like 4.18e-20
Family PDI-like 0.074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0B1T8V8
Sequence length 508
Comment (tr|A0A0B1T8V8|A0A0B1T8V8_OESDE) Uncharacterized protein {ECO:0000313|EMBL:KHJ92232.1} KW=Complete proteome; Reference proteome OX=61180 OS=Oesophagostomum dentatum (Nodular worm). GN=OESDEN_07886 OC=Strongylida; Strongyloidea; Cloacinidae; Oesophagostomum.
Sequence
MRIALLILGLAVAVISEEDYYKLLGIERDADDRTIRKAFKKLAIQKHPDKNKDPHIFIDF
QDNPQAHAEFVKINKAYEVLKDEETRKKYDQFGEKGLEDGFQGGNTYESWQFYNENFGIY
DDDPEIITLNRADFQRQVSEFNEMWFINFYSTFCSHCHQLAPTWRKFAKSMEGAIRIGAV
NCAEDPGLCQSQRVYAYPSLVIYPTVLYLKTDNIKPLAMEYQPYSSRPWIIDFCQRTGDC
LSNMNRRKLAAMLEGLVNVGTVDCSLSAEHELCEELDASAGVSYYPARKIQKGYEQKMDC
LDPKELAEEALGYLDDIQEIGESGLKGLLDGTESPTAVLFVQSKDALNEKKDYKKLPAAL
PDVKKLPQFVTFKTTGGYEIDYANKKTYYDVRAFIKESITSPLHVLSEEAYNSAVKSGQL
WIIDYFAPWCPPCLRLIGEYRRLHSIIDRRDEVLPKLKIGLIDCQKFNHICQRAGVQSYP
TSALYTPDGRVQQFVGFHAAATVLELID
Download sequence
Identical sequences A0A0B1T8V8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]