SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0B2S5R0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0B2S5R0
Domain Number 1 Region: 26-124
Classification Level Classification E-value
Superfamily Chaperone J-domain 3.4e-28
Family Chaperone J-domain 0.00023
Further Details:      
 
Domain Number 2 Region: 204-311
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00000000000672
Family Thioltransferase 0.095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0B2S5R0
Sequence length 469
Comment (tr|A0A0B2S5R0|A0A0B2S5R0_GLYSO) DnaJ like subfamily C member 16 {ECO:0000313|EMBL:KHN39562.1} KW=Complete proteome; Reference proteome OX=3848 OS=Glycine soja (Wild soybean). GN=glysoja_041086 OC=Phaseoleae; Glycine; Soja.
Sequence
MKTRFPSTRVIFVASLCFLASFELLQAKTIDPYKVLGVDKNASQREIQKAFHKLSLQYHP
DKNKSKGAQEKFSQINNAYEILSDEEKRKNYDMYGDEKGNPGFQGGHPGGQGGYTFTGGG
PGQSHFNFKPGGDWQGMGGQGGSKSFSFSFGRGSGDSNPFGFGLDDLFGSFFGGGGGGSQ
FGGFGSSAKSQSGSKSSSKSLRAVNSQIYKKEIENAGMTWLLLSYMPSSMEIQYFESTIE
EVASSLQGALKVGSINCEKEVSFCKELSIYPRRAPRLIVFSYKENEKGYLVEYRGNLAAK
NLKAFCQEYLPRFSKRTDLNHLDQFSTTGKLPRVLLLSTKKDTPVIWRVLSGLYHKRITF
IDAEALCGEKTPVCIIGAFSSSKAREKLESILSLVSPKSLAKKSLSRQPNQGSSSSRDSI
SYALLDAAKQKSFLKAFDKTEEIENFISSVLSGDVPFREATRGKPVLEY
Download sequence
Identical sequences A0A0B2S5R0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]