SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0B4K602 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0B4K602
Domain Number 1 Region: 1497-1626
Classification Level Classification E-value
Superfamily Bromodomain 7.46e-31
Family Bromodomain 0.0000102
Further Details:      
 
Domain Number 2 Region: 1640-1739
Classification Level Classification E-value
Superfamily Bromodomain 7.33e-30
Family Bromodomain 0.00011
Further Details:      
 
Domain Number 3 Region: 12-76
Classification Level Classification E-value
Superfamily TAF(II)230 TBP-binding fragment 1.23e-20
Family TAF(II)230 TBP-binding fragment 0.0000206
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0B4K602
Sequence length 2172
Comment (tr|A0A0B4K602|A0A0B4K602_DROME) TBP-associated factor 1, isoform E {ECO:0000313|EMBL:AFH06271.1} KW=Complete proteome; Reference proteome OX=7227 OS=Drosophila melanogaster (Fruit fly). GN=CG17603 OC=Ephydroidea; Drosophilidae; Drosophila; Sophophora.
Sequence
MEMESDNSDDEGSIGNGLDLTGILFGNIDSEGRLLQDDDGEGRGGTGFDAELRENIGSLS
KLGLDSMLLEVIDLKEAEPPSDDEEEEDARPSAVSASEGMSAFDALKAGVKREDGAVKAQ
DDAIDYSDITELSEDCPRTPPEETSTYDDLEDAIPASKVEAKLREDIAQIFKGLCNSCQS
DTITFAPLRLGSDLLLYRENNSHFVAAKDDKELMPPPSAPMRSGSGGGIEEPAKSNDASS
PSDDSKSTDSKDADRKLDTPLADILPSKYQNVDVRELFPDFRPQKVLRFSRLFGPGKPTS
LPQIWRHVRKRRRKRNQSRDQKTTNTGGSDSPSDTEEPRKRGFSLHYAAEPTPAECMSDD
EDKLLGDFNSEDVRPEGPDNGENSDQKPKVADWRFGPAQIWYDMLEVPDSGEGFNYGFKT
KAASTSSQPQLKDERRVKSPEDDVEDPSIADDAFLMVSQLHWEDDVVWDGNDIKAKVLQK
LNSKTNAAGWLPSSGSRTAGAFSQPGKPSMPVGSGSSKQGSGASSKKAQQNAQAKPAEAP
DDTWYSLFPVENEELIYYKWEDEVIWDAQQVSKVPKPKVLTLDPNDENIILGIPDDIDPS
KINKSTGPPPKIKIPHPHVKKSKILLGKAGVINVLAEDTPPPPPKSPDRDPFNISNDTYY
TPKTEPTLRLKVGGNLIQHSTPVVELRAPFVPTHMGPMKLRAFHRPPLKKYSHGPMAQSI
PHPVFPLLKTIAKKAKQREVERIASGGGDVFFMRNPEDLSGRDGDIVLAEFCEEHPPLIN
QVGMCSKIKNYYKRKAEKDSGPQDFVYGEVAFAHTSPFLGILHPGQCIQAIENNMYRAPI
YPHKMAHNDFLVIRTRNNYWIRSVNSIYTVGQECPLYEVPGPNSKRANNFTRDFLQVFIY
RLFWKSRDNPRRIRMDDIKQAFPAHSESSIRKRLKQCADFKRTGMDSNWWVIKPEFRLPS
EEEIRAMVSPEQCCAYFSMIAAEQRLKDAGYGEKFLFAPQEDDDEEAQLKLDDEVKVAPW
NTTRAYIQAMRGKCLLQLSGPADPTGCGEGFSYVRVPNKPTQTKEEQESQPKRSVTGTDA
DLRRLPLQRAKELLRQFKVPEEEIKKLSRWEVIDVVRTLSTEKAKAGEEGMDKFSRGNRF
SIAEHQERYKEECQRIFDLQNRVLASSEVLSTDEAESSASEESDLEELGKNLENMLSNKK
TSTQLSREREELERQELLRQLDEEHGGPSGSGGAKGAKGKDDPGQQMLATNNQGRILRIT
RTFRGNDGKEYTRVETVRRQPVIDAYIKIRTTKDEQFIKQFATLDEQQKEEMKREKRRIQ
EQLRRIKRNQERERLAQLAQNQKLQPGGMPTSLGDPKSSGGHSHKERDSGYKEVSPSRKK
FKLKPDLKLKCGACGQVGHMRTNKACPLYSGMQSSLSQSNPSLADDFDEQSEKEMTMDDD
DLVNVDGTKVTLSSKILKRHGGDDGKRRSGSSSGFTLKVPRDAMGKKKRRVGGDLHCDYL
QRHNKTANRRRTDPVVVLSSILEIIHNELRSMPDVSPFLFPVSAKKVPDYYRVVTKPMDL
QTMREYIRQRRYTSREMFLEDLKQIVDNSLIYNGPQSAYTLAAQRMFSSCFELLAEREDK
LMRLEKAINPLLDDDDQVALSFIFDKLHSQIKQLPESWPFLKPVNKKQVKDYYTVIKRPM
DLETIGKNIEAHRYHSRAEYLADIELIATNCEQYNGSDTRYTKFSKKILEYAQTQLIEFS
EHCGQLENNIAKTQERARENAPEFDEAWGNDDYNFDRGSRASSPGDDYIDVEGHGGHASS
SNSIHRSMGAEAGSSHTAPAVRKPAPPGPGEVKRGRGRPRKQRDPVEEVKSQNPVKRGRG
RPRKDSLASNMSHTQAYFLDEDLQCSTDDEDDDEEEDFQEVSEDENNAASILDQGERINA
PADAMDGMFDPKNIKTEIDLEAHQMAEEPIGEDDSQQVAEAMVQLSGVGGYYAQQQQDES
MDVDPNYDPSDFLAMHKQRQSLGEPSSLQGAFTNFLSHEQDDNGPYNPAEASTSAASGAD
LGMDASMAMQMAPEMPVNTMNNGMGIDDDLDISESDEEDDGSRVRIKKEVFDDGDYALQH
QQMGQAASQSQIYMVDSSNEPTTLDYQQPPQLDFQQVQEMEQLQHQVMPPMQSEQLQQQQ
TPQGDNDYAWTF
Download sequence
Identical sequences A0A0B4K602
NP_001246952.1.81976 FBpp0293442 FBpp0293442

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]