SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0B4K634 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0B4K634
Domain Number 1 Region: 79-205
Classification Level Classification E-value
Superfamily PH domain-like 4.11e-27
Family Pleckstrin-homology domain (PH domain) 0.0038
Further Details:      
 
Domain Number 2 Region: 352-480
Classification Level Classification E-value
Superfamily NAD kinase/diacylglycerol kinase-like 5.89e-24
Family Diacylglycerol kinase-like 0.016
Further Details:      
 
Domain Number 3 Region: 1456-1638
Classification Level Classification E-value
Superfamily NAD kinase/diacylglycerol kinase-like 1.09e-22
Family NAD kinase-like 0.073
Further Details:      
 
Domain Number 4 Region: 1852-1915
Classification Level Classification E-value
Superfamily SAM/Pointed domain 1.57e-18
Family SAM (sterile alpha motif) domain 0.0071
Further Details:      
 
Domain Number 5 Region: 251-322
Classification Level Classification E-value
Superfamily Cysteine-rich domain 7.03e-17
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0000608
Further Details:      
 
Domain Number 6 Region: 185-248
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.000000000000688
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0B4K634
Sequence length 1918
Comment (tr|A0A0B4K634|A0A0B4K634_DROME) Diacylglycerol kinase {ECO:0000256|RuleBase:RU361128} KW=Complete proteome; Reference proteome OX=7227 OS=Drosophila melanogaster (Fruit fly). GN=CG34384 OC=Ephydroidea; Drosophilidae; Drosophila; Sophophora.
Sequence
MAHLKLDTLHVQRSPRGSRRSSPSSGRSSACSSGSISPVPIIPIISISHDGDESESESEI
ETEPARLFQRRMSTKCTNNLAAIIKEGFLLKHTWSFQRWRRRYFRLKRNMLFYAKDEKCD
VFDDIDLSDLCYFECGIKNVNHSFQIITPTRSLVLCAESRREMEDWLGSLKTATAPQRPR
GDSFLIEQHDILSNHHHWYATSHARPTYCNVCRDALSGVTSHGLSCEVCKCKVHKRCAAK
SIANCKWTTLASVGKDIIEQADGIIMPHQWMEGNLPVSSMCAVCKKTCGSVLRLQDWRCL
WCRATVHVACRPQMAVACPIGPAKLSVVPPTSVHSISTDDAWDVASPKGNFSPLLVFVNS
KSGDNQGVKFLRRFKQLLNPAQVFDLISTGPSLGLRLFRHFEMFRILVCSGDGSVGWVLS
EIDRFNMHKQCQVAVMPLGTGNDLARVLGWGSSCDDDTHLPQILERYESASTKMLDRWSI
MVFEKAIPVPKTPKMSISTEQEAMLTGMVTSANHHLRFIVETNDTQTLIRSTRNLCDTVD
DLVCRISEHHKDDEQLAVKCDILRQKLNMLLDALQEEEIGAHSGDDLIATIRSLIARSIP
VTPGSNAYLLNPNISIEKTEKDQINTKERRNSRSLRSSEKEALQCRANSVKRAIYNVVEH
SEPGRPKRYQRKLSITPFEALKLPTASGESTPCTSPLPIIPPINIISPTMETSRLTCISP
LPDTRRDSVDENFFNSINLPAPRQFADSRRSSGVEVIQEIEEGANGETVYRKSRMSLTGG
ANIDDAGNRLSPCSDAGENTPTERKVDFLRVPIHTGEPIVDPLCDYRPHEVFERTYYMTR
EMDKGKEKDKEKDKPVEIDKEKDTCVEKEGSMPAEKLVHTCNLQVPGVVVTPNPQNVYSS
ASITIIDTDAQTTTEQSSSDDLGGEASDVLSAISNEECSVASEIFDKQDAGQTVGDIIQN
MDASNFTHIDSPETSDETEAMPGESIMDDISSVLGHDITYALQDNTLTDDTTTLCSEHAG
PPKPPRKKSLSALSRTQAHPRRRNSSPPRMARLARMDSDDNPQQFGFENIVFEIDNRCDD
QKMREPPRYCSLAQFVEGNDIARQSFKRPKKRTSLKKPKPTTTTEIVSQQQLMLEQHRGG
DNDSDYPEHEQTPTNKGANLLATTSEDELSTQTAIKIEIQDIDATVRNLNSSMKPNTILT
TSTSPTKKSGHGQDVKRITFDESCKKESFDDVNPNYPQISVVVRPPTPLRGDCIKPTVSL
LPVSSGGAMTVSMTCSGMLGVRAMNASEIRRHSSHAPGLAVREFDKDKDRRHSGFNPNQL
TLDPEHARFLSSSPAASRRISCGSLFKPNEALPNLQTLKGSKSSLFMGSTLFGFDHLASA
EKDKEEKSGKDKEKTPTDETNRKLPIINPLVRLPNWPNLANGGGFISKCLLANADTLCAA
VSPLMDPDETLLAGYHEKCVMNNYFGIGIDAKISLDFHNKREEHPEKCRSRARNYMWYGV
LGSKQLLQKTCKNLEQRVQLECDGQRIPLPELQGIVILNIPSFMGGTNFWGSSKKDDIFL
PPSFDDRVLEVVAVFGSVQMAASRLINLQHHRIAQCQSVQINILGDEEIPIQVDGEAWLQ
PPGMIRILHKNRVQMLCRNRSLELSLKSWQEKQRQHSISIQRDASSTASEHANSTDEVIS
ERECYVLLNFIEAVSSLVKWVKFLIISHPALQHDLYEVACRASEALESIHPQGKLLEGPS
LRTKLVEVIDSSRQLYDDACTLLRDRGHSLILREDLETKLSAALANMEMELKKCSVQKCI
DGKLRAYFNVLAPNEESDGRRKSRPFWVRLRSGSTAGQQAFKPPLTNTREAANNWSVNEV
VTWLETMQLSEYVDSFLKNDIRGKELLTLGRRDLKDLGVVKVGHVKRILQAIKDLSEN
Download sequence
Identical sequences A0A0B4K634
FBpp0293457 NP_001246969.1.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]