SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0B4KFU1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0B4KFU1
Domain Number 1 Region: 132-465
Classification Level Classification E-value
Superfamily L domain-like 4.08e-48
Family Internalin LRR domain 0.058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0B4KFU1
Sequence length 1155
Comment (tr|A0A0B4KFU1|A0A0B4KFU1_DROME) 2mit, isoform B {ECO:0000313|EMBL:AGB95911.1} KW=Complete proteome; Reference proteome OX=7227 OS=Drosophila melanogaster (Fruit fly). GN=CG42573 OC=Ephydroidea; Drosophilidae; Drosophila; Sophophora.
Sequence
MVKIVNQHCDLGLALLLAWTWLTRLVVAAHLVDIPTSSRLAAEREEQQLSRQDVGRLSYQ
SIHRMLRDENEPDSFRGELRYQQKRHKRELELNAPANKLNLTHRDLRTFNSTGGQWKGDF
QVITAMDLSSNQLESLSLDNFNQLRQLDLGNNSLEVIPLSLADTNMSLPFVTLDLSCNKF
SQISTSFFAQRLPQLKNLNLAHNELLNISRESFYNLLELQTLVLSHNNISDIDYETFLAL
PNLQYLDLSHNRLSGSAIRALQGIPDLVSLSIAYNPDVGVAMQEFVASWSLKELDASGTG
LCQVPAALAQSVRTLKLSDNWLKAINCGDMDSYPLLQYLDLSHSRIAQVEDDALGRLELL
ESLFLDRNLLMRVPSSLPPSLEHLFLQHNQIMELPPQAFVGLVNLQTLDLSNNRLIFLPP
LSLPKLLTLNLESSGVESVSQSIVHTLPQLRDLLLEDNPIKCSDLLGIAEWASPCRSVDA
GQSNGASVSGRVDLKTEYLQFHNFYENFSSRECGIRKPENDTKPPSCSLTRASATLTTTP
RSMSKVEKSQEAQATATSVEVAAATAATSEKTGIQATSAAQSTAAATTAEREAIATATSS
DTTATPTLAAAAAIQSAGNIPAQLTTKTLRPTETTSLAQLQRRQQMPGMPAKTTETPAKN
LPSLAQTKATTALPILATRDAATATTEINSDKPTNISGATKTVATSAAEIATPPAIEVPQ
TILAGKKSDKMPADKAHETLLKYPTRDTSGQVATTPHKHATLQLHVKDRHLIGTPLLMHK
GDVLLVDAEQLLLPGTATVADADSEVLDPSQQHQSAEQEKHQSATDKRQADAINGDTKSP
AKGHKKKPSLSIKKMTYSTKHAAKTVEDMAATSKTPQHQHSSVNTPKEAAPEELSTFAQL
KAYVELKSESKPEHLMDQREENHHNLTGNHPGVMLLVACVLFIVLLAGLAHVYRCELPWQ
RSNRSGQLRPHHQRHLNETDDAHSFLHYQGSVNSNGGDPARLQKWHHSTRREAPYSSPLH
NLQARELQQQRCQQFYSSSLADKSSSTSSSSSGSSRSSLHSPSRDDSYYIEMAPSSPPAA
NLPSLPMELLGSRSNALGCRTDRVAATDLGGTTEAVPSSAAAIKSVSSRLMTPSSRRLNI
WXQTVFGQRQYAPFQ
Download sequence
Identical sequences A0A0B4KFU1
NP_001262529.1.81976 FBpp0303176

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]