SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0B4KH79 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0B4KH79
Domain Number 1 Region: 171-378
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.71e-29
Family DNA replication initiator (cdc21/cdc54) N-terminal domain 0.015
Further Details:      
 
Domain Number 2 Region: 431-629,704-794
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.26e-19
Family Extended AAA-ATPase domain 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0B4KH79
Sequence length 885
Comment (tr|A0A0B4KH79|A0A0B4KH79_DROME) Recombination-defective, isoform B {ECO:0000313|EMBL:AGB95995.1} KW=Complete proteome; Reference proteome OX=7227 OS=Drosophila melanogaster (Fruit fly). GN=CG31293 OC=Ephydroidea; Drosophilidae; Drosophila; Sophophora.
Sequence
MNPTLSRGGAPSRFVRGRGRGGGAYRPYFYFRRNGRVIPAGGNRQPNQGEPGAPDAPSVP
PATRQPRGWSRTAGKRGRNAHLDCSFLRPENYAAPEDGLQVQSIAVDNPRAYSGWRLYFL
REKYEEGNELATRIMAVEAYYQRNPHTFDFVMIRDRGFFPLCAAGIKSDAQLKEVWPSLS
EDIREHPLRTLGTLSLAMHTVVVNHQLDCNDSTTAMVSTPEQYVLPTPRVRKIYARPDDF
VPVESIEGISHSRVDTLFSIRGFVSNVGEPSYSLTWQAFRCSRCQMEIAMRQRGTFQPRP
YQCKRSECVARDEFVPLRSSPYTRLSIRQIIRVEESSLNLVHDFETSMPAEMDVELRHDL
VDAVRVGQEVVVTGILKLQELGDDTTTGDTSNQMQPYLKAVSIRDASSIKREFSERDLEA
IVMINAEPNSFKLLVQSIAPEVYGHELPKAACLLSLLGGKGAETEAINVLLVGDPGIGKT
KILQSCAQIAERGAHVSGKRGAQSAQQLGVTFAGRNKRVLQAGSLMMASGGGHCTLDDVD
KLASKQAVLLQCLQSEEVNLPLAGAFASFPAQPSVIACANPQRGQYDEGRYLLQNINISP
SLLREFHLVYILLDKPSERDMSLTAHVRALHAGARKRARIAARYALKPKMSDSMCEVSLN
VPAAGKDDDTIKTEDDNDSIMQQDYDLDKRLEVLPEEGDLDLLPPILIKKFLSYARQELN
PVLNEDASNAVLRYFLELKGSCNLDEDVSSQIGAGQLLAIIHLSQARARLDLSHVVSPQH
VRDVIALLTESITQTSLKEGSSRQGTRGGGGAGGGAGKSAQLRNFLELTKRRSAALGRRI
FEFDELKEIGTRAGILTGFSQLVEMANLGGYLLMKGANMYEVVPD
Download sequence
Identical sequences A0A0B4KH79 Q9VF30
7227.FBpp0082647 FBpp0082647 FBpp0082647 FBpp0082647 NP_001262615.1.81976 NP_732072.1.81976 FR563

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]