SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0B4KHN4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0B4KHN4
Domain Number 1 Region: 162-427
Classification Level Classification E-value
Superfamily L domain-like 7.48e-61
Family Internalin LRR domain 0.013
Further Details:      
 
Domain Number 2 Region: 363-621
Classification Level Classification E-value
Superfamily L domain-like 1.73e-48
Family Ngr ectodomain-like 0.071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0B4KHN4
Sequence length 641
Comment (tr|A0A0B4KHN4|A0A0B4KHN4_DROME) Sur-8, isoform F {ECO:0000313|EMBL:AGB96044.1} KW=Complete proteome; Reference proteome OX=7227 OS=Drosophila melanogaster (Fruit fly). GN=CG5407 OC=Ephydroidea; Drosophilidae; Drosophila; Sophophora.
Sequence
MNLCSSGATASTTSLSSTGQAERSGGVPGGGAEGGGGSGNSGGGGKTSNGSAEAPTLCFA
GGSGTAGAIAGTEELSNANSPANGAGGATGSTGSGQQPTGSNGHSHLHNENNANMPPETR
PKMVTVKHPESNKPKPTTKKSKPIQADQDVIKALQRCRDEGIKRLDLSKSSITVIPSTVK
ECVHLTELYLYSNKIGQLPPEIGCLVSLRNLALNENSLTSLPESLQNCSQLKVLDLRHNK
LAEIPPVIYRLRSLTTLYLRFNRITAVADDLRQLVNLTMLSLRENKIRELGSAIGALVNL
TTLDVSHNHLEHLPEDIGNCVNLSALDLQHNELLDIPDSIGNLKSLVRLGMRYNRLSSVP
ATLKNCKSMDEFNVEGNGITQLPDGMLASLSGLTTITLSRNQFASYPTGGPAQFTNVYSI
NLEHNRIDKIPYGIFSRAKGLTKLNMKENMLTALPLDIGTWVNMVELNLATNALQKLPDD
IMNLQNLEILILSNNMLKKIPNTIGNLRKLRILDLEENRIEVLPHEIGLLHELQRLILQT
NQITMLPRSIGHLGNLTHLSVSENNLQFLPEEIGSLESLENLYINQNPGLEKLPFELALC
QNLKYLNIDKCPLSTIPPEIQAGGPSLVLQWLKMHSPYRQM
Download sequence
Identical sequences A0A0B4KHN4 Q9VEK6
FBpp0082888 FBpp0082889 FBpp0306061 NP_001262664.1.81976 NP_650620.3.81976 NP_732231.2.81976 7227.FBpp0082889 FBpp0082888 FBpp0082888 FBpp0082889

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]