SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0B4KHW1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0B4KHW1
Domain Number 1 Region: 41-330
Classification Level Classification E-value
Superfamily Clavaminate synthase-like 1.37e-60
Family Hypoxia-inducible factor HIF ihhibitor (FIH1) 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0B4KHW1
Sequence length 441
Comment (tr|A0A0B4KHW1|A0A0B4KHW1_DROME) Phosphatidylserine receptor, isoform B {ECO:0000313|EMBL:AGB96212.1} KW=Complete proteome; Reference proteome OX=7227 OS=Drosophila melanogaster (Fruit fly). GN=CG5383 OC=Ephydroidea; Drosophilidae; Drosophila; Sophophora.
Sequence
MSEEFKLPKRSRKRTREVKRKARPELDGENAWSAMRYCEKFEPFWDFTDNLERIEESQVP
ESEFIERFERPYKPVVIRGCTDGWLALEKWTLARLAKKYRNQKFKCGEDNEGYSVKMKMK
YYVEYMQSTRDDSPLYIFDSSFGEHHRRRKLLDDYVVPKYFRDDLFQYCGENRRPPYRWF
VMGPARSGTGIHIDPLGTSAWNTLIRGHKRWCLFPTQTPKELLKVTSAMGGKQRDEAITW
FSTIYPRTQLPSWPEQYRPIEVLQGAGETVFVPGGWWHVVLNMDDTIAITQNFSSQTNFP
CVWHKTVRGRPKLSRKWLRVLRDQRPELAQIADSINLNESTGFASDSSSNSSSSSSSSSS
SSEEEESDDGGDSNTDSGQESLTAKKKKKRRMAGGGSGSGSMGGSSRSXSRERAKRKGLL
MRLFQRQLMLLRGLPRRCRLS
Download sequence
Identical sequences A0A0B4KHW1
FBpp0303404 NP_001262832.1.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]