SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0B4KHX5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0B4KHX5
Domain Number 1 Region: 283-387,513-674,707-840
Classification Level Classification E-value
Superfamily L domain-like 6.63e-49
Family Internalin LRR domain 0.016
Further Details:      
 
Domain Number 2 Region: 41-386
Classification Level Classification E-value
Superfamily L domain-like 1.36e-43
Family Internalin LRR domain 0.051
Further Details:      
 
Domain Number 3 Region: 852-1082,1109-1224
Classification Level Classification E-value
Superfamily L domain-like 2.04e-32
Family Ngr ectodomain-like 0.012
Further Details:      
 
Domain Number 4 Region: 404-568
Classification Level Classification E-value
Superfamily L domain-like 7.65e-21
Family Ngr ectodomain-like 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0B4KHX5
Sequence length 1338
Comment (tr|A0A0B4KHX5|A0A0B4KHX5_DROME) Chaoptin, isoform D {ECO:0000313|EMBL:AGB96516.1} KW=Complete proteome; Reference proteome OX=7227 OS=Drosophila melanogaster (Fruit fly). GN=CG1744 OC=Ephydroidea; Drosophilidae; Drosophila; Sophophora.
Sequence
MGLEFFFKFGYAFLTITLMIMIWMSLARASMFDREMEETHYPPCTYNVMCTCSKSSTDLG
IVHCKNVPFPALPRMVNQSKVFMLHMENTGLREIEPYFLQSTGMYRLKISGNHLTEIPDD
AFTGLERSLWELILPQNDLVEIPSKSLRHLQKLRHLDLGYNHITHIQHDSFRGLEDSLQT
LILRENCISQLMSHSFSGLLILETLDLSGNNLFEIDPNVFVDGMPRLTRLLLTDNILSEI
PYDALGPLKSLRTLDISHNVIWSLSGNETYEIKASTKLNLDNLHLEYNHIEVLPPNSFKY
FDTVNRTFFDGNPIHTLREDAFKPARIREIYMRYCGLTNISPVAFDSLVNSLQILDLSGN
NLTKLHHKLFNNFDVLRVISMRDNKIKIQKPTETFNAVHYTLLKLDLSGDRNDPTNLQTL
RKMRNMRSLSISRLGSSSVGPEDFKDFGVELEDLQITRASLSGIQSHAFKHVRGLKRLDF
SENGISSIENDAFHEIGHSLISLKMSHGYSGSALPAEPLRHLTSLQELDFSNNHISSMSD
TSFHFLKNLRLLELHDNRIEQVLKGTFQGDIHSKLEEISLRFNHLTSISQHTFFDLEALR
KLHLDDNKIDKIERRAFMNLDELEYLSLRGNKINNLADESFQNLPKLEILDMAFNQLPNF
NFDYFDQVGTLSNLNVNVSHNQIRQLMYNSSWSGRNEHGGMYHSNIKILDLSHNNISIIH
PGYFRPAEISLTHLHLGYNSLMNTTRDVFGNMPHLQWLDLSYNWIHELDFDAFKNTKQLQ
LVFFGHNYLSDIPQDIFKPVQGLRIVDFSHNHLRGLPDNLFYNGGMEKLDVSHNMMLKIP
SSSLSSLAALTLCELHLSNNFISTIHSMDLSNKFRSLRYLDISYNYLLRIDDAVFATMPK
LAVLDLSHNRDLKVMDKSFMGLENSLIKLGLENISLSTVPEIRLKYLREFRLGYNELPSI
PQELAHNMSNLRMLDLSNNDLTNVPLMTQALPHLRRLMLSGNPITSLNNNSFDGVNEDLE
MLDISNFRLHYFEYGCLDSLPHLRSLKLTAYSHLEHFNIPHLLRHHYNIRQLWIEAPQPF
TRIVKKGSGPTQEMQTLQLGNPTDLQREMEGHLPSKLTNITFSGPQFTNLNERILRGMRS
PYLYMQLFNTSLQALPPNFFKYMGRVRNISLDIRYHNRNLKKIPNPNTGAVPYLPNSVFL
TDLKMSHTDLNCDCDLGWVEFWQRKRRQYICSSQTWTDTVFRTFMNSPCQVYGRHNCDEH
DDDLRETRCENKGGQQLMEALKFDLECGWDNANCREAAFVVVMVCVAMVFWMXLLHFTYK
TSTDFYTILEQVYGRQVI
Download sequence
Identical sequences A0A0B4KHX5
FBpp0303134 NP_001263137.1.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]