SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0B5GCQ6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0B5GCQ6
Domain Number 1 Region: 540-586
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000017
Family TSP-1 type 1 repeat 0.0011
Further Details:      
 
Domain Number 2 Region: 57-104
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000144
Family TSP-1 type 1 repeat 0.002
Further Details:      
 
Domain Number 3 Region: 118-151
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000183
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 4 Region: 494-533
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000345
Family EGF-type module 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0B5GCQ6
Sequence length 587
Comment (tr|A0A0B5GCQ6|A0A0B5GCQ6_EPICO) C8beta protein {ECO:0000313|EMBL:AJF19173.1} OX=94232 OS=Epinephelus coioides (Orange-spotted grouper) (Epinephelus nebulosus). GN=C8beta OC=Epinephelini; Epinephelus.
Sequence
MLPVVTRTSALSLQRFLLYVTVSLVLLSEAADTTASDGDPGVREARSMGHQVVVHPVDCV
LSEWSSWSRCDTCQKKRYRYAKLEQPSQFGGQPCNFHDREEEACDVPARYTCDSVPVCEG
FFCNQTGRCIPRTLQCSGEDDCGDMSDEAGCKKVSKPCREEAEEYWGIENLAKGISILNS
NLEGVVLDNRYYAGSCLPQYIQDVRFRKPHNLQQYTMQTKGSYDFTLQSFESYSDWKHTL
EERLSQTTVSFGFAIPFIVEFGFNYNKAKYSKKEQKIRRAASKTNSFVRAKAELELAQYM
LKSDDLMLHPELLQRLRSLPQSYVYGEYRQIYRDYGTHYITEAALGGDFEHTIILNKEKL
AKSDYTLDDYARCTQSGLKVGANIYGVYVSAGFHGGSCNGLLNEMGEDTDHGSMVEDFVA
VVRGGSSESITALLSKKLPTPQLMGLWGEGVQFNPDFLRTTTRLLYELVTSRDFSHHATL
KRNLKKALSEYLAEADACRCAPCQNNGVAVLRGTRCDCVCPTGYTGRGCEITNRQKDLAI
DGSWSCWGAWSSCSGQKKTRSRQCNNPAPRDGGLECRGLQEESTECF
Download sequence
Identical sequences A0A0B5GCQ6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]