SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0B5GWQ0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0B5GWQ0
Domain Number 1 Region: 12-216
Classification Level Classification E-value
Superfamily FMN-dependent nitroreductase-like 1.07e-52
Family NADH oxidase/flavin reductase 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0B5GWQ0
Sequence length 223
Comment (tr|A0A0B5GWQ0|A0A0B5GWQ0_9EURY) Cob(II)yrinic acid a,c-diamide reductase {ECO:0000313|EMBL:AJF26642.1} KW=Complete proteome OX=1592728 OS=Haloarcula sp. CBA1115. GN=SG26_13325 OC=Haloarcula.
Sequence
MVEFGPRDREAVYKSIYSRRDIRRFAADSVPEDVLTRVLDAAHNAPSVGFSQPWDFVVIE
DEQTKSAVAAIAERAIAAAREGYEEPRKSDFGQLKLEGITDAPVNICVTCDPTRAAPHVL
GRNTMRRMDVYSTCLAVQNLWLAARAEGIGVGWVSFLYPHELRAVLNIPHHVQPVAYLCV
GYPEDGFPAEPVLQREGWRNRIDRTELVHYDEWDPSRTPETKS
Download sequence
Identical sequences A0A0B5GWQ0 A0A165M1N9 G0HXI9 V5TLG9
gi|564289379|ref|YP_008875619.1| gi|344211389|ref|YP_004795709.1| WP_014040001.1.13069 WP_014040001.1.27393 WP_014040001.1.67629 WP_014040001.1.92404 WP_014040001.1.92869

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]