SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0B5JC25 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0B5JC25
Domain Number 1 Region: 3-58
Classification Level Classification E-value
Superfamily F-box domain 0.0000000432
Family F-box domain 0.0078
Further Details:      
 
Domain Number 2 Region: 90-200
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0000157
Family Pseudo ankyrin repeat 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0B5JC25
Sequence length 279
Comment (tr|A0A0B5JC25|A0A0B5JC25_9VIRU) F-box domain protein {ECO:0000313|EMBL:AJF97137.1} KW=Complete proteome; Reference proteome OX=1605721 OS=Pandoravirus inopinatum. GN= OC=Viruses; dsDNA viruses, no RNA stage; unclassified dsDNA viruses.
Sequence
MATVTTMDDLPDEIIELILGELDHIADRIAAHCVCRLWRERLAQARRYAWALCRTDLWAV
AVCALENGKWSATSWLLDGRDQLSARGNRLLLAATRADNADAVAWLRARGCKWTPDLAAK
AIAEGHKKVIDQARDDGHLCHKDVLCALAQIDDTETLQSIACLSSSALASIIRAATASGS
VAVLRWLYERDASWATPDEAKRIILKGHLRTVVWAVEEAGMTIDSQWLYTALEKERLDTV
VWFHRAGSNGDKGAESRFPDATRSSGRRSDRAAPTLPRA
Download sequence
Identical sequences A0A0B5JC25
YP_009119372.1.13463

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]