SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0B5QN06 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0B5QN06
Domain Number 1 Region: 7-57
Classification Level Classification E-value
Superfamily Clostridium neurotoxins, "coiled-coil" domain 0.0000994
Family Clostridium neurotoxins, "coiled-coil" domain 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0B5QN06
Sequence length 103
Comment (tr|A0A0B5QN06|A0A0B5QN06_CLOBE) Uncharacterized protein {ECO:0000313|EMBL:AJH02201.1} KW=Complete proteome OX=1520 OS=Clostridium beijerinckii (Clostridium MP). GN=LF65_05694 OC=Clostridium.
Sequence
MRIEEIRKLIKNIIDNEFNHISEFKERKDFDSNDTIKELSEKVNDVLDKLNELLPDQQDL
IGELDDLYSNYCTNACKYYFREGVAAGTTNLKFLEETKTMHLV
Download sequence
Identical sequences A0A0B5QN06
WP_041900701.1.15846

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]