SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0B5X5W8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0B5X5W8
Domain Number 1 Region: 6-138
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.0000000000000126
Family SMI1/KNR4-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0B5X5W8
Sequence length 142
Comment (tr|A0A0B5X5W8|A0A0B5X5W8_BACCO) SMI1 / KNR4 family protein {ECO:0000313|EMBL:AJH78369.1} KW=Complete proteome OX=1121088 OS=Bacillus coagulans DSM 1 = ATCC 7050. GN=BF29_1341 OC=Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Bacillus.
Sequence
MANFEFMNRYKHKIYNVTENDILIAEQRMNISFPSDLKQFYLEVGYGFIKGQSANAINRI
LGAGAVADFRLGEGIFEFAANLDALYDENKLIFFEVNEDVYISIDLELVNNPVFYFDISI
ASSLEDFFKKFLNNNEYYINSI
Download sequence
Identical sequences A0A0B5X5W8
WP_029142140.1.13965 WP_029142140.1.54696 WP_029142140.1.69771 WP_029142140.1.88820

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]