SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0B6Y0P6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0B6Y0P6
Domain Number 1 Region: 79-123
Classification Level Classification E-value
Superfamily SOCS box-like 0.00000000929
Family SOCS box-like 0.0038
Further Details:      
 
Domain Number 2 Region: 6-50
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.000000233
Family Ankyrin repeat 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0B6Y0P6
Sequence length 152
Comment (tr|A0A0B6Y0P6|A0A0B6Y0P6_9EUPU) Uncharacterized protein {ECO:0000313|EMBL:CEK49366.1} OX=1028688 OS=Arion vulgaris. GN=ORF7477 OC=Stylommatophora; Sigmurethra; Arionoidea; Arionidae; Arion.
Sequence
MAVGVNTALFLINNGAACDTPDKNGMRPLDRAAHVGHIGMLRLLLGCDCRRTTTIMDVPR
VVQSRQSLPVFDRWLQQELYSPRELKRLCRQTIRQCLSPMNTANMEQLPIPRLMKDYLLA
KHLDLTFANISIDHVQNIVPVSLDNIGHRLQR
Download sequence
Identical sequences A0A0B6Y0P6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]