SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0B7K8W5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0B7K8W5
Domain Number 1 Region: 372-458,512-536
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 0.0000000451
Family Regulator of G-protein signaling, RGS 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0B7K8W5
Sequence length 578
Comment (tr|A0A0B7K8W5|A0A0B7K8W5_BIOOC) Uncharacterized protein {ECO:0000313|EMBL:CEO51972.1} OX=29856 OS=Bionectria ochroleuca (Gliocladium roseum). GN=BN869_000008030_1 OC=Clonostachys.
Sequence
MATSDNVNVYDLPPSPPKWDRVGIFFVSFCGTWSSLVFAGMVFCWLNRRSPILRIRGLPL
SFSAILLLHTYWILAQLMYPVGRTLPIVVTYDIQYFFMGIWLPLGIALLHASNSRLICIA
KLQRQFASQPLVRVTCNGGDSSVLCRFRSLECTAKLMMLISAGMILQVVLAIGMWMACRK
YHPAFGIPGTGIHGNNLSEQMRDLGRGWEWWPSVVWQVLWAWVVAPILNWRARGIHDTMG
WRTQIIGCCISNLHATPMFLIAQYVPAFESVNAYFHPIQWINLSIMMFEVFTVFIPVFQV
IKLQMQCRKAAASHARWETSFQATAMGLSHLFGQVRKESAMSMEAGPMMDHLLSEEMSDQ
VSTMGALEFVLRANPSPLQDFAALKDFSGENVAFLSRVASWKSAYSDAIQGPRELEAYNA
ALQIYTDFISPRRAEFPLNLSATQLKCLEEIFEEPPRSLCGEPTVNSATRFDIEQPPSPS
SLPRSSLGEGSGAQEVRARYMGEIPRGFSNSVFDTTHSNIRYQVLTNTWPRFIEDMRERR
RVSGQTDYPSRVPRHGHSSGVFQVFFALPPEVDGLNHL
Download sequence
Identical sequences A0A0B7K8W5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]