SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0B7NNU6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0B7NNU6
Domain Number 1 Region: 146-293
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00000000000000358
Family Thioltransferase 0.089
Further Details:      
 
Domain Number 2 Region: 334-473
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000000000284
Family UBX domain 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0B7NNU6
Sequence length 492
Comment (tr|A0A0B7NNU6|A0A0B7NNU6_9FUNG) Uncharacterized protein {ECO:0000313|EMBL:CEP17205.1} KW=Complete proteome; Reference proteome OX=35722 OS=Parasitella parasitica. GN=PARPA_11499.1 OC=Mucoraceae; Parasitella.
Sequence
MESLTDHQRAILQEYQVSVDKTTEAACVYADNILKKSRNYSQNIASSIRTLQANNWDVEV
RRLCKLLDEAHHVLTHSALSLLSKTRTKTQSHPHPLHRCWATQAQHQQECQTSAFSCGYS
CGLSVCFTTTARLLYRPSISAPRRDARSEADRFLRDFESTYGTTHPVFFSEGGYTQALRA
ARKEFKYMLVVLCSEEHDDNARFCKDVLTDMDLLDFLHHHQVIVWGGNVRYTEAYQVSST
LQATTYPFLAIIALQQTNGTSKMAVLDRIEGPVPASSVIRRFEAVIARAGPLLDRLRMEL
LQRANERRLRQQQDQAYRDSLAADQRKQELLEEKKKAALKAKQARQELARKRRQYIQYLC
QRELKQPNPAAAADADADAKITKISFRLSNGDRVIHQFRGDDTLVSLYEYIEVYSHMDIM
GHGNESISPPEDYIHQYRFTMHSTFPRMVYLPDPSKKISDEKGLWPSATLIVDTNENNQE
QQEEEEDSDQEA
Download sequence
Identical sequences A0A0B7NNU6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]