SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0B8RT02 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0B8RT02
Domain Number 1 Region: 35-148
Classification Level Classification E-value
Superfamily PH domain-like 8.46e-38
Family Enabled/VASP homology 1 domain (EVH1 domain) 0.000041
Further Details:      
 
Domain Number 2 Region: 240-369
Classification Level Classification E-value
Superfamily Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 4.45e-30
Family Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.0000164
Further Details:      
 
Domain Number 3 Region: 428-488
Classification Level Classification E-value
Superfamily Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.000000000000615
Family Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.00068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0B8RT02
Sequence length 500
Comment (tr|A0A0B8RT02|A0A0B8RT02_PIG) Wiskott-Aldrich syndrome {ECO:0000313|EMBL:JAG69050.1} OX=9825 OS=Sus scrofa domesticus (domestic pig). GN=WAS OC=Sus.
Sequence
MSGGPAGGRPGGRGGAAVQQNIPSALLQDHENQRLFEMLGRKCWTLATAVVQLYLALPPG
AEHWTKEHCGAVCFVKDNPQKSYFIRLYGLQAGRLLWEQELYSQLVYSTPTPFFHTFAGD
ECQAGLNFADEGEAQAFRALVHEKIQKRNQRQSGDRRQLPTPPTPANEERRGALPPVPPH
PGGDQGGQGSSSLSLVTVDIQNPDITNSRYRGLPTPGPGPGDKKRSGKKKISKADIGAPS
GFKHVSHVGWDPQNGFDVNNLDPDLRSLFSRAGISEAQLTDAETSKFIYDFIENQGGMEA
VRKEMRRQEPLPPPPPPSRGGNQLPRPPTVGSNKGRSGPLPPVPTGGAPPPPIPRGPPPP
GRGGPPPPPPPATGRSVPPPPPPPGAGGPTLPPPPPPPPPPPSCGDGPIPPPPPPSLGLV
GGPAPGGGRGALLDQIRQGIQLNKTPGAPESSALQPPPQSSEGLVGALMHVMQKRSKAIH
SSDEGEDQAGDDDDDDEWDD
Download sequence
Identical sequences A0A0B8RT02 A0A286ZTG3
XP_020935720.1.46622 XP_020935721.1.46622 XP_020935722.1.46622 XP_020935723.1.46622

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]