SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0C2FJ29 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0C2FJ29
Domain Number 1 Region: 6-145
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.000000000000706
Family SMI1/KNR4-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0C2FJ29
Sequence length 147
Comment (tr|A0A0C2FJ29|A0A0C2FJ29_9ACTN) Cell wall assembly protein {ECO:0000313|EMBL:KIH99274.1} KW=Complete proteome; Reference proteome OX=183763 OS=Streptomonospora alba. GN=LP52_08915 OC=Streptomonospora.
Sequence
MILGVWRELIVELYPRAELAEPADEAAVALIEKELGLPVPFELASFFGECDGVCNEYGDA
VVWPVRRVVEDNLAMRAEPDYVELYAPFEELIFFGDSDMGPQFAWVHTDYGPGIVVWDHE
TDRRRLVAVSLRDYLVRCLGEGGGWWR
Download sequence
Identical sequences A0A0C2FJ29
WP_040272431.1.71031

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]