SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0C2I9D7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0C2I9D7
Domain Number 1 Region: 19-54,194-332
Classification Level Classification E-value
Superfamily Oligoxyloglucan reducing end-specific cellobiohydrolase 0.00000000106
Family Oligoxyloglucan reducing end-specific cellobiohydrolase 0.024
Further Details:      
 
Domain Number 2 Region: 764-794
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000563
Family LDL receptor-like module 0.0023
Further Details:      
 
Domain Number 3 Region: 541-664
Classification Level Classification E-value
Superfamily YWTD domain 0.0000288
Family YWTD domain 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0C2I9D7
Sequence length 845
Comment (tr|A0A0C2I9D7|A0A0C2I9D7_THEKT) Sortilin {ECO:0000256|SAAS:SAAS00711445} KW=Complete proteome; Reference proteome OX=669202 OS=Thelohanellus kitauei (Myxosporean). GN=RF11_14159 OC=Platysporina; Myxobolidae; Thelohanellus.
Sequence
MLSKYFSYDFQRENIVYEMYVSRSFGNNFEHISDHVVEAAWIQNTSYIIYIANSVVRIID
VAHNYTEMFKFYSVKRFHQIRNEFIVIEYDQAFEKDMILEILHLNENKNLTAKIVHENHF
GVKSNYKIYKKYNEFFYLNGALYILVWKNSYTLCLCTFNQYDQIIELVCDLSLYDTSGGK
CSVVINPHLSGVIYANLHKTGLKTRTYASFDNGKNFVPLEFKDKTSECQENACGVELDLE
CSTDLIESTFPEKWMVKLKGTLHRKNRGSYHTFFSFNGGKSWKIVDSHVENLTILNRGSV
LFGTEVMSGRIWFSYNEGWSWYRQDIAASNIIDVKPIESPNTQLISAIDYDMVKKVFSLF
IFDFSHVLNRTCEDKDYAAFYITRFSGNCFQGQEVYFWKKKADSVCVDNRNSVLQMTRPC
PCSPEDFQCERNYYFKDNFCVLNPYSNAKESVKKCRDGGTPLNNLNGFAKLNPDICSSRH
IDLDEDSEYCDYCISNNFSIQIFVFFNDNLQELQLDYKGGYLPASEFIKNSLPMRISAKN
AITYDPRSKAIYLFLIHTIYRFDDKTNNFTSDKTSLYRLSFGIVSMAYDYWNTLLFFLDT
HSRLFVISLTDNYIKLLSSNVTSFQFHMSSLAISFSTFNQICYYRMFWNIICFDAEMNIR
KYVYSPESQYHFVLLQNNTLFIAKHPIGGKSIIHQEISLKLSQPMYIENPIEINHPYGSS
MCQYTCNPLIRTADFCYCSDSNESPKEYMCKEGDAKCLNKLCVGFRCNNGQCRRNNIRCD
RIDDCGDNTDEKNCDQTCSDNKHLCQGKCILKSKICPDLSYEYLDPDMPESVPSKSRTDV
SYEYF
Download sequence
Identical sequences A0A0C2I9D7
KII61883

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]