SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0C2J7Z3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0C2J7Z3
Domain Number 1 Region: 375-588
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 2.09e-46
Family DBL homology domain (DH-domain) 0.00033
Further Details:      
 
Domain Number 2 Region: 206-326
Classification Level Classification E-value
Superfamily BRCT domain 7.56e-17
Family DNA topoisomerase II binding protein 1, TopBP1 0.039
Further Details:      
 
Domain Number 3 Region: 100-221
Classification Level Classification E-value
Superfamily BRCT domain 0.00000000000707
Family DNA topoisomerase II binding protein 1, TopBP1 0.083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0C2J7Z3
Sequence length 856
Comment (tr|A0A0C2J7Z3|A0A0C2J7Z3_THEKT) Protein ECT2 {ECO:0000313|EMBL:KII73934.1} KW=Complete proteome; Reference proteome OX=669202 OS=Thelohanellus kitauei (Myxosporean). GN=RF11_05540 OC=Platysporina; Myxobolidae; Thelohanellus.
Sequence
MDIALQGTSLVTDESYSFDQNCSSILVVQTNQKPDLIYRIFIIGDLLETNPSLNECILRH
LKQNPLVTCCTLNEQEALATYAQPTTTNMDTSETIFILPDFESPLFSALKKLGVRVYGPT
GAIDMINRSVDLNSPNIPNVYTFSLSKAIIVFSGFGVAQKKELSYLNRIAHYMGAKVKQE
LNSSVTHLVSPHVKSSLYDDSVGLGVIPLTPDWLKFCWDQRHDPAFLGTNTMVTKNYFIK
PFTGLFLAFHAFSASEIKELEPLVFENGGFITDINSQDVTHVVVNYTGENDFPFPPRENI
WVVNIKWFYESVKLQIKRPEATHIVSQIERKKKKIAFDEPASQSLHLPKPVTKTSTMHTF
MNNKRRSREKSSIEEDKQNRRYCTFQELLETESNYIEMLNVMIQVFKEEIVKENKSQLDP
IMSNEEIKDTFSYIEPIINIHENIFVELKDIFEKWNSKSSLGRVYDKEVPGMIRAYSAYI
NFFEKTKSLIDHKMRTNHRFHAVIKFCEINPRCQRQAFKDLLIRPVQRLPSVILLYKEIL
KHTDPVCSDHQQIAETIEKLTYVLNQINEDKKRTSEQLQNMEIFNRIEECPADFLSSKRK
FLFSVDCYEFQDNPKSRSSLMTLFIMCDCIEVTYKMVKKSHPIDFALSPLQYTVANKILS
LKKMKSFKHAYLIPFKYIDQLIEINDTTTTWKYSFGLKFKSREFDESKTRYYQIVADDPS
EKQKSIIDILTKSVTCSKTVMDVSQNKQSPIVSLGRALENLAFKASRRMSRAFSINNSHN
GLPRCMSVMSQINPDSMKSVNNLGDTASYTNEFENVSSTNSSQILHSSSNGKKAEKGRKQ
FSLWRRSIQPSDIQKR
Download sequence
Identical sequences A0A0C2J7Z3
KII73934

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]