SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0C3AY23 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0C3AY23
Domain Number 1 Region: 417-497,525-550
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000000000031
Family UBX domain 0.029
Further Details:      
 
Domain Number 2 Region: 226-313
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0000000000962
Family UAS domain 0.071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0C3AY23
Sequence length 588
Comment (tr|A0A0C3AY23|A0A0C3AY23_9HOMO) Uncharacterized protein {ECO:0000313|EMBL:KIM24884.1} KW=Complete proteome; Reference proteome OX=933852 OS=Serendipita vermifera MAFF 305830. GN=M408DRAFT_331551 OC=Agaricomycetes; Sebacinales; Serendipitaceae; Serendipita.
Sequence
MEALTDAERATLSQLQAIMNDQGDVDTQISLLQSVDWDLQAATQMIYGDERPPAPRVPTT
RRDEEEARPLMEPMEIDDTLVFGTQPPRTATYAFPGGRNAGPGRVGGLGLFSLLMAPFSI
TLNILSSLLHFVFRVLRIPFPRLRLGAGSAGSSYRSGRRGSYSDDPAVVAERWVRELEEE
TGAMCISKAALIDAQGNGNGVAGESEAGPSSGSGLVRRHAAKTKTLPDFFLGGYDAALKA
AQRDAKVLCVILTSEEHDDVPAFRRDVLTDPEFVRVLTDNQMLVWGGDVRERDGYQAALK
LGVTTYPFVAFMSLYARRDGPDALTVITRHSGPPTSITSASALCGHITGTVLPRVAPVLN
RKRAEQRSREYERKLREDQDRAYAESQVKDYERIVKHRAEEQRKREEEQARRLEAQRREE
LAQAAAAERQRREDQKMAWRRYARRMLVREEIPGSTTAVSIKIRMPSGKQLVRRFERTDT
VTSLYAFVASQFIPEGELPEDDPLEPPGGGEFGKNVEDHDWDWEFQLAVAFPKSVIGWTK
GDRKTIGDVGVLKGGGNLVVEMQRPIETGASTVLTDEDDDETASEDSE
Download sequence
Identical sequences A0A0C3AY23
jgi|Sebve1|331551|fgenesh1_kg.43_#_47_#_Locus6390v1rpkm19.79

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]